[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2241
DDBJ      :CPE2241      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:50 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->45 1mvoA PDBj 8e-08 50.0 %
:RPS:PDB   1->45 3dqqB PDBj 2e-09 8.9 %
:RPS:SCOP  1->45 1tmyA  c.23.1.1 * 9e-08 26.7 %
:HMM:SCOP  1->45 1s8nA_ c.23.1.1 * 1e-06 28.9 %
:HMM:PFM   3->40 PF00072 * Response_reg 6.6e-06 34.2 38/112  
:BLT:SWISS 2->45 PHOP_BACSU 8e-08 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81947.1 GT:GENE CPE2241 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2563901..2564053) GB:FROM 2563901 GB:TO 2564053 GB:DIRECTION - GB:GENE CPE2241 GB:PRODUCT hypothetical protein GB:NOTE 50 aa, no significant homology GB:PROTEIN_ID BAB81947.1 LENGTH 50 SQ:AASEQ MKILLVEDEESIRGFLRINFQRENFQVIECESGEEGVRKALIEKPRYSNT GT:EXON 1|1-50:0| BL:SWS:NREP 1 BL:SWS:REP 2->45|PHOP_BACSU|8e-08|50.0|44/240| BL:PDB:NREP 1 BL:PDB:REP 2->45|1mvoA|8e-08|50.0|44/121| RP:PDB:NREP 1 RP:PDB:REP 1->45|3dqqB|2e-09|8.9|45/412| HM:PFM:NREP 1 HM:PFM:REP 3->40|PF00072|6.6e-06|34.2|38/112|Response_reg| RP:SCP:NREP 1 RP:SCP:REP 1->45|1tmyA|9e-08|26.7|45/118|c.23.1.1| HM:SCP:REP 1->45|1s8nA_|1e-06|28.9|45/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 98.0 SQ:SECSTR ccEEEEEccHHHHHHHHHHHHTTTccEEEEEccccccccTTccEEcEEE# DISOP:02AL 46-50| PSIPRED cEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccccc //