[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2248
DDBJ      :CPE2248      probable chromate transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->183 PF02417 * Chromate_transp 2e-14 33.9 %
:HMM:PFM   3->184 PF02417 * Chromate_transp 4.6e-50 38.9 167/169  
:BLT:SWISS 1->182 YWRA_BACSU 6e-16 27.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81954.1 GT:GENE CPE2248 GT:PRODUCT probable chromate transport protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2579928..2580497) GB:FROM 2579928 GB:TO 2580497 GB:DIRECTION - GB:GENE CPE2248 GB:PRODUCT probable chromate transport protein GB:NOTE 189 aa, similar to pir:B70156 probable chromate transport protein from Borrelia burgdorferi (177 aa); 34.8% identity in 178 aa overlap. 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81954.1 LENGTH 189 SQ:AASEQ MILIRLFLEFFKVGLFAVGGGAATIPFLYNISDKTHWFTHTDLANMIAISQSVPGAMGINMATYVGYATYGVLGAITSTIGIIVPSIIIILIVARVLAKFKENKRVADCFYGLRPASTGLLLAAGFEIVKISILTLNKYAETHNIADILSIKALILAGILFFFIRKYKKSPIFYIIASAIVGIIFNFAK GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 1->182|YWRA_BACSU|6e-16|27.1|170/178| TM:NTM 5 TM:REGION 6->28| TM:REGION 43->65| TM:REGION 74->96| TM:REGION 143->164| TM:REGION 170->189| SEG 76->93|itstigiivpsiiiiliv| RP:PFM:NREP 1 RP:PFM:REP 2->183|PF02417|2e-14|33.9|168/170|Chromate_transp| HM:PFM:NREP 1 HM:PFM:REP 3->184|PF02417|4.6e-50|38.9|167/169|Chromate_transp| GO:PFM:NREP 2 GO:PFM GO:0015109|"GO:chromate transmembrane transporter activity"|PF02417|IPR003370| GO:PFM GO:0015703|"GO:chromate transport"|PF02417|IPR003370| OP:NHOMO 101 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------113212-1--------------------------------------------------1-------1---------------1------------------1---1---------------111111----22-2---------1-------------------------------------------------------------------------------------------25--2222222222-2--122212-31-32--------121-22--212-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2-1-------------------------1-311-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 189-190| PSIPRED cHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc //