[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2266
DDBJ      :CPE2266      conserved hypothetical protein
Swiss-Prot:Y2548_CLOP1  RecName: Full=UPF0178 protein CPF_2548;

Homologs  Archaea  0/68 : Bacteria  200/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   16->143 PF02639 * DUF188 1e-21 39.1 %
:HMM:PFM   15->142 PF02639 * DUF188 6.3e-42 33.6 128/130  
:BLT:SWISS 1->149 Y2548_CLOP1 2e-84 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81972.1 GT:GENE CPE2266 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2604658..2605107) GB:FROM 2604658 GB:TO 2605107 GB:DIRECTION - GB:GENE CPE2266 GB:PRODUCT conserved hypothetical protein GB:NOTE 149 aa, similar to gpu:AP001511_263 BH1374 gene product from Bacillus halodurans (157 aa); 41.7% identity in 132 aa overlap GB:PROTEIN_ID BAB81972.1 LENGTH 149 SQ:AASEQ MKIIIDGDGCAGRDIIEEVGKKHSVKILIYCTINHMINSDYSEVRMVDGGFQSVDMYVANNTEENDIVITQDYGVAAMALGKGALAISPRGYIYDNDNIDRLLFERHLSQKNRRAGGKSKGNHKRNKEDDDRLYYNLEVLIEKVKAILN GT:EXON 1|1-149:0| SW:ID Y2548_CLOP1 SW:DE RecName: Full=UPF0178 protein CPF_2548; SW:GN OrderedLocusNames=CPF_2548; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|Y2548_CLOP1|2e-84|100.0|149/149| RP:PFM:NREP 1 RP:PFM:REP 16->143|PF02639|1e-21|39.1|128/130|DUF188| HM:PFM:NREP 1 HM:PFM:REP 15->142|PF02639|6.3e-42|33.6|128/130|DUF188| OP:NHOMO 200 OP:NHOMOORG 200 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-----------------------------------------------------------------1----------------------------------------------11111111111111111111111111-1111-11111111111111111111111111111----------------------------------------------------------------------111111111111111-11111111----11111111-111-------------11-----1------------111111111111-----------------------11--1-1----------11111111-11---1------------------------------------1----------------1------------------------------------11-------------111--11-1---1----111-1-111----1--1--------------------------------1111-1-111111111111111111------1-------------------------------------------------------------------1----------11111111111---------1111--1-1-----------------1111--------------------------------1---111111---1-----------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 109-129| PSIPRED cEEEEEcccccHHHHHHHHHHHcccEEEEEEccccccccccEEEEEEcccccHHHHHHHHHcccccEEEEcccHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHc //