[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2282
DDBJ      :CPE2282      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->163 PF05137 * PilN 3e-06 22.3 %
:HMM:PFM   49->167 PF05137 * PilN 6.7e-08 17.7 113/162  
:BLT:SWISS 20->130 HEM1_CLOK5 1e-04 32.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81988.1 GT:GENE CPE2282 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2626419..2626985) GB:FROM 2626419 GB:TO 2626985 GB:DIRECTION - GB:GENE CPE2282 GB:PRODUCT hypothetical protein GB:NOTE 188 aa, no significant homology 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81988.1 LENGTH 188 SQ:AASEQ MRDFNFFSHITEERKSDSKRKYIGFGLIGALVFIFAVNFSINIIHGHVLDKNISYYEGEIDNPDMKEKLGIATKVEKEHDALEKYYNDVKVATEQVYDNNYVTTQRIKIINSTVPKDLVFTQISIDNKTLTIQALSKTRSAISDLQYNLNNLGFIENTYISGIGERNAQGDYSFSINCTLKEVGNNEN GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 20->130|HEM1_CLOK5|1e-04|32.7|101/399| TM:NTM 1 TM:REGION 24->46| RP:PFM:NREP 1 RP:PFM:REP 12->163|PF05137|3e-06|22.3|148/162|PilN| HM:PFM:NREP 1 HM:PFM:REP 49->167|PF05137|6.7e-08|17.7|113/162|PilN| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-1----1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 13-17, 184-188| PSIPRED ccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEcccccEEEcccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHHHEEEEcccccccEEEEEEEEcccEEEEEEHHHHHHHHHHHHHcccccccEEHHHHcccccccccccEEEEEEEEEEEcccccc //