[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2294
DDBJ      :CPE2294      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->129 PF09719 * C_GCAxxG_C_C 4e-30 38.4 112/120  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82000.1 GT:GENE CPE2294 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2638493..2638897) GB:FROM 2638493 GB:TO 2638897 GB:DIRECTION - GB:GENE CPE2294 GB:PRODUCT hypothetical protein GB:NOTE 134 aa, no significant homology 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB82000.1 LENGTH 134 SQ:AASEQ MLVEKAREKWDKKHDLNCAECIMYAANEEYNLNLSKETLKVMSSFGGGLAIGNVCGAATGAAGVLGLMFTEDRGHQSPQTRALTQEFMEKFYDKLGYYNCTDLKAKYKKDDDRRCIVMIETAAEVLDEIVRRER GT:EXON 1|1-134:0| SEG 56->67|gaatgaagvlgl| HM:PFM:NREP 1 HM:PFM:REP 17->129|PF09719|4e-30|38.4|112/120|C_GCAxxG_C_C| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-1----1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 133-134| PSIPRED ccHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcc //