[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2302
DDBJ      :CPE2302      conserved hypothetical protein
Swiss-Prot:REX_CLOPE    RecName: Full=Redox-sensing transcriptional repressor rex;

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.2.1
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->211 2vt3B PDBj 8e-28 33.0 %
:RPS:PDB   7->209 2dt5B PDBj 6e-19 36.3 %
:RPS:SCOP  13->81 1xcbA1  a.4.5.38 * 7e-05 44.9 %
:RPS:SCOP  109->206 1xcbA2  c.2.1.12 * 2e-13 43.3 %
:HMM:SCOP  8->81 1xcbA1 a.4.5.38 * 7.2e-22 44.6 %
:HMM:SCOP  82->209 1xcbA2 c.2.1.12 * 5.2e-31 30.2 %
:RPS:PFM   7->54 PF06971 * Put_DNA-bind_N 2e-12 58.3 %
:RPS:PFM   106->172 PF02629 * CoA_binding 2e-04 26.2 %
:HMM:PFM   83->179 PF02629 * CoA_binding 2.1e-28 30.1 93/96  
:HMM:PFM   5->54 PF06971 * Put_DNA-bind_N 5.1e-27 62.0 50/50  
:BLT:SWISS 1->212 REX_CLOPE e-112 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82008.1 GT:GENE CPE2302 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2646762..2647400) GB:FROM 2646762 GB:TO 2647400 GB:DIRECTION - GB:GENE CPE2302 GB:PRODUCT conserved hypothetical protein GB:NOTE 212 aa, similar to pir:G72408 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (208 aa); 37.9% identity in 198 aa overlap GB:PROTEIN_ID BAB82008.1 LENGTH 212 SQ:AASEQ MEKKKGISMAVIKRLPKYHRYLQELMENDVDRISSKELSEKIGFTASQIRQDLNCFGDFGQQGYGYNVKELYNNIGSILGLTRDYNTVIIGAGNIGQAIANYNSFNRLGFKLKGIFDANPRMFGIKIRDVEIQDVEKLKDFVKENDIEIGIICVPRTNAQKVCNDLVEGGIKGIWNFAPIDLEVPKDIRVENVHLSESMMTLVYLLNHNDVK GT:EXON 1|1-212:0| SW:ID REX_CLOPE SW:DE RecName: Full=Redox-sensing transcriptional repressor rex; SW:GN Name=rex; OrderedLocusNames=CPE2302; SW:KW Complete proteome; Cytoplasm; DNA-binding; NAD; Repressor;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->212|REX_CLOPE|e-112|100.0|212/212| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 89->103|iigagnigqaianyn| BL:PDB:NREP 1 BL:PDB:REP 7->211|2vt3B|8e-28|33.0|203/208| RP:PDB:NREP 1 RP:PDB:REP 7->209|2dt5B|6e-19|36.3|201/211| RP:PFM:NREP 2 RP:PFM:REP 7->54|PF06971|2e-12|58.3|48/50|Put_DNA-bind_N| RP:PFM:REP 106->172|PF02629|2e-04|26.2|65/95|CoA_binding| HM:PFM:NREP 2 HM:PFM:REP 83->179|PF02629|2.1e-28|30.1|93/96|CoA_binding| HM:PFM:REP 5->54|PF06971|5.1e-27|62.0|50/50|Put_DNA-bind_N| GO:PFM:NREP 4 GO:PFM GO:0005737|"GO:cytoplasm"|PF06971|IPR009718| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF06971|IPR009718| GO:PFM GO:0016564|"GO:transcription repressor activity"|PF06971|IPR009718| GO:PFM GO:0051775|"GO:response to redox state"|PF06971|IPR009718| RP:SCP:NREP 2 RP:SCP:REP 13->81|1xcbA1|7e-05|44.9|69/74|a.4.5.38| RP:SCP:REP 109->206|1xcbA2|2e-13|43.3|97/126|c.2.1.12| HM:SCP:REP 8->81|1xcbA1|7.2e-22|44.6|74/74|a.4.5.38|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->209|1xcbA2|5.2e-31|30.2|126/0|c.2.1.12|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 275 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- --1-1-------------------------------111111111-------111--1--111-1111111-----------1-----1111-111----------------------------------------11111---11-------------------------------------11111111-1111111111111111111111111111111111111111111111111111111-111112111221111111112221111111111111111111111111111111111111111111111111111121111111111111111111111121111131111111311211111-11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111111-------1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------2112222222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 96.7 SQ:SECSTR ######ccccHHHHHHHHHHHHHHHHHTTccEEcHHHHHHHTTccHHHHHHHHHHTTccccTTTcEEHHHHHHHHHHHHTTTccEEEEEEcccHHHHHHHTccccccccEEEEEEEEccTTTTTcEETTEEcEEGGGGGGTcTTTccEEEEEcccHHHHHHHHHHHHHHTccEEEEcccccccccTTcEEEEccTTTHHHHHHHHHHcTcc# DISOP:02AL 1-5, 210-212| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHccccccccEEEEEEEccHHHccEEEccEEEEcHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccEEEEEEEcEEEEcccccEEEEEEHHHHHHHHHHHHHccccc //