[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2305
DDBJ      :CPE2305      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.286.1
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->56 2ek5C PDBj 1e-04 32.7 %
:RPS:PDB   6->58 3eetA PDBj 1e-11 20.8 %
:RPS:PDB   136->204 2bkoA PDBj 7e-12 23.2 %
:RPS:SCOP  7->59 1e2xA1  a.4.5.6 * 8e-10 18.9 %
:RPS:SCOP  135->204 1vctA2  d.286.1.1 * 4e-14 22.9 %
:HMM:SCOP  1->99 1v4rA1 a.4.5.6 * 9e-12 22.2 %
:HMM:SCOP  119->205 1vctA2 d.286.1.1 * 2.1e-17 34.5 %
:RPS:PFM   135->204 PF02080 * TrkA_C 2e-06 34.8 %
:HMM:PFM   135->202 PF02080 * TrkA_C 7.5e-17 31.3 67/71  
:HMM:PFM   10->72 PF00392 * GntR 1.4e-11 28.6 63/64  
:BLT:SWISS 10->133 YYDK_BACSU 9e-05 27.7 %
:BLT:SWISS 145->204 Y2680_BACFR 2e-04 32.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82011.1 GT:GENE CPE2305 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2650598..2651218) GB:FROM 2650598 GB:TO 2651218 GB:DIRECTION - GB:GENE CPE2305 GB:PRODUCT conserved hypothetical protein GB:NOTE 206 aa, similar to pir:C69405 hypothetical protein AF1244 from Archaeoglobus fulgidus (161 aa); 38.3% identity in 60 aa overlap GB:PROTEIN_ID BAB82011.1 LENGTH 206 SQ:AASEQ MESKVNEPIYKQIALDIAGRIYNNDIKVGQKIHGRSTLASSYNVSPETVRKAVKLLEDMKVVSSSKGSGVTIISKDNAYNFINRFHSIESVTSLKHDIESLMEEKKAIEKNIGEMIDKIVDYSNRLRYTNPLTPIEIELPKDCTLIGKSVSESKFWQNTQATIVAIRRKGELIISPGPYLKFEKDDNLLVVGEEDILKKIEMFLNK GT:EXON 1|1-206:0| BL:SWS:NREP 2 BL:SWS:REP 10->133|YYDK_BACSU|9e-05|27.7|119/236| BL:SWS:REP 145->204|Y2680_BACFR|2e-04|32.2|59/532| SEG 60->75|kvvssskgsgvtiisk| BL:PDB:NREP 1 BL:PDB:REP 8->56|2ek5C|1e-04|32.7|49/117| RP:PDB:NREP 2 RP:PDB:REP 6->58|3eetA|1e-11|20.8|53/238| RP:PDB:REP 136->204|2bkoA|7e-12|23.2|69/190| RP:PFM:NREP 1 RP:PFM:REP 135->204|PF02080|2e-06|34.8|69/71|TrkA_C| HM:PFM:NREP 2 HM:PFM:REP 135->202|PF02080|7.5e-17|31.3|67/71|TrkA_C| HM:PFM:REP 10->72|PF00392|1.4e-11|28.6|63/64|GntR| GO:PFM:NREP 2 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 7->59|1e2xA1|8e-10|18.9|53/73|a.4.5.6| RP:SCP:REP 135->204|1vctA2|4e-14|22.9|70/94|d.286.1.1| HM:SCP:REP 1->99|1v4rA1|9e-12|22.2|99/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 119->205|1vctA2|2.1e-17|34.5|87/0|d.286.1.1|1/1|TrkA C-terminal domain-like| OP:NHOMO 70 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1-------------------11-1111111111-11-----------11111111111111--------1---1122222221211111122211--------11-11----11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 80.1 SQ:SECSTR ccccccccHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHTT#########################################cHHHHHHHHHHTccTTccccTHHHHHHHccccEEEEEEccTTcTTTTccHHHHTHHHHHccEEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHHHHHHHHHHT DISOP:02AL 1-6, 8-9| PSIPRED ccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccEEEEEEEEccEEEEcccccEEEccccEEEEEccHHHHHHHHHHHcc //