[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2334
DDBJ      :CPE2334      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.12
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->96 3g1cA PDBj 1e-29 61.5 %
:RPS:PDB   17->99 1co0A PDBj 6e-11 25.3 %
:HMM:SCOP  1->99 1trrA_ a.4.12.1 * 2e-31 50.5 %
:RPS:PFM   14->96 PF01371 * Trp_repressor 2e-20 59.0 %
:HMM:PFM   12->96 PF01371 * Trp_repressor 2.9e-37 47.1 85/88  
:BLT:SWISS 7->98 YERC_BACSU 3e-30 63.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82040.1 GT:GENE CPE2334 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2686351..2686650) GB:FROM 2686351 GB:TO 2686650 GB:DIRECTION - GB:GENE CPE2334 GB:PRODUCT conserved hypothetical protein GB:NOTE 99 aa, similar to pir:B69794 hypothetical protein yerC from Bacillus subtilis (104 aa); 63% identity in 92 aa overlap GB:PROTEIN_ID BAB82040.1 LENGTH 99 SQ:AASEQ MNGVQSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKASTATISRVNRCLNYGADGYNNILNRLDEK GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 7->98|YERC_BACSU|3e-30|63.0|92/100| BL:PDB:NREP 1 BL:PDB:REP 6->96|3g1cA|1e-29|61.5|91/97| RP:PDB:NREP 1 RP:PDB:REP 17->99|1co0A|6e-11|25.3|83/105| RP:PFM:NREP 1 RP:PFM:REP 14->96|PF01371|2e-20|59.0|83/88|Trp_repressor| HM:PFM:NREP 1 HM:PFM:REP 12->96|PF01371|2.9e-37|47.1|85/88|Trp_repressor| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01371|IPR000831| GO:PFM GO:0005622|"GO:intracellular"|PF01371|IPR000831| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01371|IPR000831| HM:SCP:REP 1->99|1trrA_|2e-31|50.5|99/0|a.4.12.1|1/1|TrpR-like| OP:NHOMO 95 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------11-111---------------111111---111111111111111-1111111111111111111----------------------------------------------------------------------11-1111111111111-1111111-1111111-11111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-----------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 94.9 SQ:SECSTR #####GGGccHHHHHHccccccTTccHHHHHHHHHHHccTHHHHHHHHHHHHHHHHTccccccHHHHHTccHHHHHHHHHHHHHccccHHHHHHHTTTc DISOP:02AL 1-8, 98-99| PSIPRED ccHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHcc //