[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2365
DDBJ      :CPE2365      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  275/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:285 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   206->282 2cz4B PDBj 4e-11 13.3 %
:RPS:PFM   111->191 PF02588 * DUF161 7e-10 43.8 %
:RPS:PFM   225->279 PF10035 * DUF2179 9e-11 50.9 %
:HMM:PFM   15->93 PF02588 * DUF161 2.8e-15 31.6 76/82  
:HMM:PFM   110->191 PF02588 * DUF161 1.5e-21 32.1 81/82  
:HMM:PFM   225->279 PF10035 * DUF2179 3.9e-25 49.1 55/55  
:BLT:SWISS 10->283 YVJA_BACSU 9e-40 35.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82071.1 GT:GENE CPE2365 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2728014..2728871 GB:FROM 2728014 GB:TO 2728871 GB:DIRECTION + GB:GENE CPE2365 GB:PRODUCT conserved hypothetical protein GB:NOTE 285 aa, similar to gpu:AP001519_119 BH3604 gene product from Bacillus halodurans (293 aa); 36.6% identity in 273 aa overlap. Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB82071.1 LENGTH 285 SQ:AASEQ MNYIKEKKELLIDNAFILIGCFIASLGVNLFLSNAKLLSGGATGIALIFQYLMGVNSGIVVLLINIPLFILSYFKLSKKFTFNSAIGMLALSLSLMITAPVSHLITLDDKLLYCVFGGAICGLGYGLVFSKGGSTGGTDIVTMIIRKKYSNFNIGSLSFVLNMCIVAVGAIFFGLETALYTLISIFVQTVLVDKVIKGIHSKQLLLIITDKEQQVINYIIEDLHRGVTSLLAEGEYTHDRKKMLYCLVTTRQMIELKNTIHYIDPNAFITIMDVSEVKGKGFKNI GT:EXON 1|1-285:0| BL:SWS:NREP 1 BL:SWS:REP 10->283|YVJA_BACSU|9e-40|35.2|267/281| TM:NTM 6 TM:REGION 11->33| TM:REGION 47->69| TM:REGION 84->106| TM:REGION 109->131| TM:REGION 151->173| TM:REGION 177->199| RP:PDB:NREP 1 RP:PDB:REP 206->282|2cz4B|4e-11|13.3|75/92| RP:PFM:NREP 2 RP:PFM:REP 111->191|PF02588|7e-10|43.8|80/82|DUF161| RP:PFM:REP 225->279|PF10035|9e-11|50.9|55/55|DUF2179| HM:PFM:NREP 3 HM:PFM:REP 15->93|PF02588|2.8e-15|31.6|76/82|DUF161| HM:PFM:REP 110->191|PF02588|1.5e-21|32.1|81/82|DUF161| HM:PFM:REP 225->279|PF10035|3.9e-25|49.1|55/55|DUF2179| OP:NHOMO 750 OP:NHOMOORG 277 OP:PATTERN ------------------------------------------1------------------------- ------------------------------------------------------------------------------1---------2222-311----1-1-111--1111111111111111-----------211-----1-------------------------------------------11-247999999997999999546646999344747955555556511111111111111222134332332132311--335334424553334444222222222222224444444444444244222333411244333333343414333333521231122-33223111112231111---------------------------11-11-111--------------11----1111------1-1-----1---------------------------------------------------------------------------------------11----1------------------------------2121221112222-------1--------1-1-----------------------------------------------------------------------21----------------------------------------------------------------------------------------------1-----------------------1--------------1-------------------------------------------------------111111112-2---------------------1---1111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 26.3 SQ:SECSTR #############################################################################################################################################################################################################EEEGGGHHHHHHHHHHTTccccEEEEEcccccccccEEEEEEEEcHHH##HHHHHHHHHHHTTEEEEEEEEETGGGG### DISOP:02AL 1-8| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccEEEcccHHcc //