[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2451
DDBJ      :CPE2451      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->43 PF01478 * Peptidase_A24 6.5e-05 31.2 32/106  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82157.1 GT:GENE CPE2451 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2798134..2798289) GB:FROM 2798134 GB:TO 2798289 GB:DIRECTION - GB:GENE CPE2451 GB:PRODUCT hypothetical protein GB:NOTE 51 aa, no significant homology Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB82157.1 LENGTH 51 SQ:AASEQ MKNALKLTFIGFLIILVGIYLAVSDIDTYGVHKVLTIVGVILAGFGIKSIK GT:EXON 1|1-51:0| TM:NTM 2 TM:REGION 3->25| TM:REGION 29->51| HM:PFM:NREP 1 HM:PFM:REP 12->43|PF01478|6.5e-05|31.2|32/106|Peptidase_A24| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccc //