[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2456
DDBJ      :CPE2456      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->70 PF05313 * Pox_P21 0.00043 23.0 61/190  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82162.1 GT:GENE CPE2456 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2802121..2802618) GB:FROM 2802121 GB:TO 2802618 GB:DIRECTION - GB:GENE CPE2456 GB:PRODUCT hypothetical protein GB:NOTE 165 aa, no significant homology Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB82162.1 LENGTH 165 SQ:AASEQ MGTMHKEVVKKRRDVAIVISIVCMSLAISLSNFFGNIKFESFNAETITDPIFLVLTLVIFFREYRKCKTSYKYSIVANQLMIHKVKANKQSTLENIKLNNIVYLGKDYSKEAKDFKTSSCKKYVCSLLDRTGHYCCIYKNGDGYNKFYFKPSKTLVDKLEKNLAI GT:EXON 1|1-165:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 45->64| HM:PFM:NREP 1 HM:PFM:REP 8->70|PF05313|0.00043|23.0|61/190|Pox_P21| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111----1111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEcEEEEEEEccccccEEEEEEEEEEEEEcccHHHHHcccEEcccHHHHHHHHHHHccEEEEEEEcccEEEEEEcccHHHHHHHHHHccc //