[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2457
DDBJ      :CPE2457      probable transport protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  315/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.328.1f.17.3
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   169->281 2iubG PDBj 2e-10 32.1 %
:RPS:PDB   1->247 3ck6C PDBj 2e-29 11.1 %
:RPS:SCOP  10->195 2bbhA1  d.328.1.1 * 1e-12 16.0 %
:RPS:SCOP  250->282 2bbjA2  f.17.3.1 * 3e-07 48.5 %
:HMM:SCOP  1->248 2iubA1 d.328.1.1 * 8.7e-51 26.0 %
:HMM:SCOP  249->312 2iubA2 f.17.3.1 * 3e-16 40.6 %
:RPS:PFM   22->311 PF01544 * CorA 3e-31 30.2 %
:HMM:PFM   25->310 PF01544 * CorA 1.2e-59 29.3 283/292  
:BLT:SWISS 26->296 CORA_METJA 9e-31 33.0 %
:BLT:SWISS 268->311 CORA_WIGBR 8e-05 37.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82163.1 GT:GENE CPE2457 GT:PRODUCT probable transport protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2802893..2803837 GB:FROM 2802893 GB:TO 2803837 GB:DIRECTION + GB:GENE CPE2457 GB:PRODUCT probable transport protein GB:NOTE 314 aa, similar to pir:A75272 probable transport protein from Deinococcus radiodurans (strain R1) (312 aa); 42.7% identity in 314 aa overlap. 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB82163.1 LENGTH 314 SQ:AASEQ MIQIYKSLSENDGTLKKIASLEPGCWVNIIAPSQEELLLISKKTGVPLEFLRAPLDDEETSRIEIEGDFILIIVDIPFTEMEDNSLTYDTYPLAIIHTKNELITVCLKNSKVLTDFSSNKVRNFYSFKKSRFILQILNRVSTYYLLYLRQIDKKSIMIEKRLHKSMKNRELVQLHSLSKSLVYFSTSLKSNEITLEKMLKLDVIQRYEEDKDVLEDVIIENKQAIEMTDIYSNILGSTMDFFASVISNNLNIVMKVLASVTILMSTLTVISGIYGMNFDYLPLLHHPYGFHIIMTLSVILCGVIAFILYKKDMF GT:EXON 1|1-314:0| BL:SWS:NREP 2 BL:SWS:REP 26->296|CORA_METJA|9e-31|33.0|261/317| BL:SWS:REP 268->311|CORA_WIGBR|8e-05|37.2|43/315| TM:NTM 3 TM:REGION 236->258| TM:REGION 262->284| TM:REGION 288->309| BL:PDB:NREP 1 BL:PDB:REP 169->281|2iubG|2e-10|32.1|112/342| RP:PDB:NREP 1 RP:PDB:REP 1->247|3ck6C|2e-29|11.1|234/236| RP:PFM:NREP 1 RP:PFM:REP 22->311|PF01544|3e-31|30.2|288/291|CorA| HM:PFM:NREP 1 HM:PFM:REP 25->310|PF01544|1.2e-59|29.3|283/292|CorA| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF01544|IPR002523| GO:PFM GO:0030001|"GO:metal ion transport"|PF01544|IPR002523| GO:PFM GO:0046873|"GO:metal ion transmembrane transporter activity"|PF01544|IPR002523| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01544|IPR002523| RP:SCP:NREP 2 RP:SCP:REP 10->195|2bbhA1|1e-12|16.0|181/223|d.328.1.1| RP:SCP:REP 250->282|2bbjA2|3e-07|48.5|33/57|f.17.3.1| HM:SCP:REP 1->248|2iubA1|8.7e-51|26.0|246/0|d.328.1.1|1/1|CorA soluble domain-like| HM:SCP:REP 249->312|2iubA2|3e-16|40.6|64/0|f.17.3.1|1/1|Magnesium transport protein CorA, transmembrane region| OP:NHOMO 431 OP:NHOMOORG 341 OP:PATTERN -----------------------1---1-1-----11122221-211211121---1-1-1---1--1 -1--1----------------------------111---1-------------------------------1111111-1-11--1111112-111---11111121212--------------11--1--112--111-111-1-1121112-----------2-1--1-------------111----1-11111111111111111--11-1111131--2133333321122222222222222311111111341111122112221111133322211112112222222222211111111111112112221111--121111111111111111111--1-1-11--1111-----1----1111--111--------------------------------------------------------------------------------------------------1-11-1111-11---------1--------------------------------------------------------11----------11--1-21-11--11111-11111111------1111----------1-1111111--11-33--------1-1------1-----1------------1--------------------------------------------------------------------------------------------------1111----1---------------111111---1-1--1-1-1--1-1--121------------------------------------------11--11-------------------------------------111111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 290 STR:RPRED 92.4 SQ:SECSTR cEEEEEcccccEEccTTcccccTTEEEEEETTcTTHHHHHHHHTTccHHHHHHHHccccccEEEEccTTcEEEEEEcccTTccTTccTTcEEEEEEEETTEEEEEEccccHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTcGGGccHHGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccccT######################## DISOP:02AL 164-173| PSIPRED ccHHHHHcccccccEEEcccccccEEEEcccccHHHHHHHHHHHcccHHHHHHHHcccccccEEEcccEEEEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //