[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2510
DDBJ      :CPE2510      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->112 2eshA PDBj 6e-06 32.0 %
:RPS:PDB   49->112 2e1nB PDBj 7e-04 23.8 %
:RPS:SCOP  49->99 1yg2A  a.4.5.61 * 1e-07 27.5 %
:HMM:SCOP  37->138 1xmaA_ a.4.5.61 * 4.2e-20 32.4 %
:RPS:PFM   43->108 PF03551 * PadR 7e-10 37.9 %
:HMM:PFM   40->121 PF03551 * PadR 3.2e-21 37.8 82/86  
:BLT:SWISS 44->95 YQJI_SHIFL 3e-04 38.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82216.1 GT:GENE CPE2510 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2875934..2876374 GB:FROM 2875934 GB:TO 2876374 GB:DIRECTION + GB:GENE CPE2510 GB:PRODUCT conserved hypothetical protein GB:NOTE 146 aa, partially similar to pir:S78039 hypothetical protein c0114 from Sulfolobus solfataricus (135 aa); 40% identity in 65 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB82216.1 LENGTH 146 SQ:AASEQ MYNDEFIKAEEKRLYDEYKKQVANLKKVQKEKDAVGQVFTKGLLPIYALYILSIQPTNGNDLAQKIGEQTNGLWFPSTGGIYPLLKKLEKQGFVTGSWDDPKRKIQKVYSLTPEGFKEFEEKKHLLKPKIKEALEVFKIIYSHLYN GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 44->95|YQJI_SHIFL|3e-04|38.5|52/207| SEG 113->129|pegfkefeekkhllkpk| BL:PDB:NREP 1 BL:PDB:REP 36->112|2eshA|6e-06|32.0|75/114| RP:PDB:NREP 1 RP:PDB:REP 49->112|2e1nB|7e-04|23.8|63/112| RP:PFM:NREP 1 RP:PFM:REP 43->108|PF03551|7e-10|37.9|66/84|PadR| HM:PFM:NREP 1 HM:PFM:REP 40->121|PF03551|3.2e-21|37.8|82/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 49->99|1yg2A|1e-07|27.5|51/169|a.4.5.61| HM:SCP:REP 37->138|1xmaA_|4.2e-20|32.4|102/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------1-1--11-111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 52.7 SQ:SECSTR ###################################ccHHHHHHHHHHHHHHHTTccEEHHHHHHHHHHHcTTEEcccHHHHHHHHHHHHHTTcEEEEEcTTccccEEEEEEc################################## DISOP:02AL 24-35, 99-102, 145-146| PSIPRED cccccccccccEEEEHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEEcccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //