[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2518
DDBJ      :CPE2518      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  174/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.136.1e.10.1
:182 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->82 2i5rC PDBj 1e-04 29.6 %
:RPS:PDB   3->151 1cy0A PDBj 6e-11 17.5 %
:RPS:SCOP  3->151 1cy0A  e.10.1.1 * 4e-11 17.5 %
:HMM:SCOP  1->119 2fcjA1 c.136.1.1 * 4e-32 45.5 %
:RPS:PFM   38->149 PF09709 * Cas_Csd1 1e-04 35.0 %
:HMM:PFM   3->75 PF01751 * Toprim 9.1e-12 35.6 73/96  
:BLT:SWISS 2->178 YABF_BACSU 3e-39 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82224.1 GT:GENE CPE2518 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2882651..2883199) GB:FROM 2882651 GB:TO 2883199 GB:DIRECTION - GB:GENE CPE2518 GB:PRODUCT conserved hypothetical protein GB:NOTE 182 aa, similar to gpu:AP001507_56 BH0056 gene product from Bacillus halodurans (185 aa); 46.9% identity in 177 aa overlap GB:PROTEIN_ID BAB82224.1 LENGTH 182 SQ:AASEQ MIKEVIVVEGRDDITAVKKAIDAEIIAVGGFGINAKVIERIKEAQKRKGVIVFTDPDFAGEKIRAIISKRVKGVKHAYIGRAEGTRAKDGNIGVENASPEAIIRALENAKITLEEKREEFTIQDLIYFGLSADPKAKVRRELLGKELRIGYGNANQVLSRLNNYGITKEEFVKAIEKIEKMI GT:EXON 1|1-182:0| BL:SWS:NREP 1 BL:SWS:REP 2->178|YABF_BACSU|3e-39|45.8|177/186| BL:PDB:NREP 1 BL:PDB:REP 2->82|2i5rC|1e-04|29.6|81/117| RP:PDB:NREP 1 RP:PDB:REP 3->151|1cy0A|6e-11|17.5|137/534| RP:PFM:NREP 1 RP:PFM:REP 38->149|PF09709|1e-04|35.0|100/578|Cas_Csd1| HM:PFM:NREP 1 HM:PFM:REP 3->75|PF01751|9.1e-12|35.6|73/96|Toprim| RP:SCP:NREP 1 RP:SCP:REP 3->151|1cy0A|4e-11|17.5|137/534|e.10.1.1| HM:SCP:REP 1->119|2fcjA1|4e-32|45.5|110/0|c.136.1.1|1/1|Toprim domain| OP:NHOMO 176 OP:NHOMOORG 175 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111-11111111111111-1111111-1-11---1-11-------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-----1----1---1--1-----111--111------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 95.6 SQ:SECSTR #ccEEEEEccHHHHHHHGGGccTTEEEEEcccTTHHHHHHHHHHHTTccEEEcccccHHHHHHHHHHHHHHccTcGGGEEEccTTTTccHHcccccccHHHHHHHHHcccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTccccTHHHHHHHHHHHHHcccHHHHTTcc####### DISOP:02AL 85-91| PSIPRED cccEEEEEEcccHHHHHHHHHcccEEEEccEEccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHccccEEEEEcHHHcccccccccEEEEccHHHHHHHHHHccccccccHHcccHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHc //