[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2530
DDBJ      :CPE2530      probable X-pro aminopeptidase
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  788/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.55.2d.127.1
:414 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->399 3ig4A PDBj e-105 50.9 %
:RPS:PDB   6->413 2bwtA PDBj 9e-77 31.9 %
:RPS:SCOP  5->169 1a16A1  c.55.2.1 * 9e-20 19.0 %
:RPS:SCOP  183->411 1a16A2  d.127.1.1 * 1e-63 44.1 %
:HMM:SCOP  1->172 2bwvA1 c.55.2.1 * 1.6e-28 27.1 %
:HMM:SCOP  173->416 2bwvA2 d.127.1.1 * 5.4e-69 43.9 %
:RPS:PFM   6->131 PF05195 * AMP_N 4e-15 31.7 %
:RPS:PFM   183->389 PF00557 * Peptidase_M24 2e-38 46.6 %
:HMM:PFM   178->390 PF00557 * Peptidase_M24 2.5e-63 45.7 197/203  
:HMM:PFM   4->130 PF05195 * AMP_N 2.9e-27 33.3 123/134  
:BLT:SWISS 6->411 AMPP_ECOLI 3e-61 35.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82236.1 GT:GENE CPE2530 GT:PRODUCT probable X-pro aminopeptidase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2897788..2899032) GB:FROM 2897788 GB:TO 2899032 GB:DIRECTION - GB:GENE CPE2530 GB:PRODUCT probable X-pro aminopeptidase GB:NOTE 414 aa, similar to sp:AMPP_ECOLI XAA-PRO AMINOPEPTIDASE (EC 3.4.11.9) (X-PRO AMINOPEPTIDASE) (AMINOPEPTIDASE P II) (APP-II) (AMINOACYLPROLINE AMINOPEPTIDASE) from Escherichia coli (440 aa); 34.5% identity in 406 aa overlap GB:PROTEIN_ID BAB82236.1 LENGTH 414 SQ:AASEQ MKSLVFTKNRENLLKKLEDNSLLVLFAGEAKRKTADEYFPFTPNRNFYYLTGVDEEKHILMIKKINGVVDEVLYILKPNLEQERWTGKTIRDYEAKEVSGIENIKYLEEFKSDLNMIFTNGIAENLYLDLERVSFDEEMSKSQSFAKEVKDRYPQVVIKDVYSDIASLRQIKCKEEVEKIKKAAHITAKGVELLMKECKPGMKEYELEAYFDFYLKQNGVKDYAFKTIAAAGVNAATLHYVDNNSEIKDGDLILFDLGAQVNYYNGDISRTFPANGKFTKRQKEVYEEVLKVNEEIINSIRPGVGFYEINDKANNLLAEACVRLGLIEDKKDYRKYYFHSIGHSLGLDTHDVGKRDIILEEGMVYTVEPGLYIEEEAIGIRIEDDVLVTKDGCEVLTKECIKSVEDIEKFMSNR GT:EXON 1|1-414:0| BL:SWS:NREP 1 BL:SWS:REP 6->411|AMPP_ECOLI|3e-61|35.0|400/441| SEG 171->182|ikckeevekikk| BL:PDB:NREP 1 BL:PDB:REP 2->399|3ig4A|e-105|50.9|391/410| RP:PDB:NREP 1 RP:PDB:REP 6->413|2bwtA|9e-77|31.9|407/440| RP:PFM:NREP 2 RP:PFM:REP 6->131|PF05195|4e-15|31.7|123/135|AMP_N| RP:PFM:REP 183->389|PF00557|2e-38|46.6|193/203|Peptidase_M24| HM:PFM:NREP 2 HM:PFM:REP 178->390|PF00557|2.5e-63|45.7|197/203|Peptidase_M24| HM:PFM:REP 4->130|PF05195|2.9e-27|33.3|123/134|AMP_N| GO:PFM:NREP 3 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF05195|IPR007865| GO:PFM GO:0030145|"GO:manganese ion binding"|PF05195|IPR007865| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 2 RP:SCP:REP 5->169|1a16A1|9e-20|19.0|163/175|c.55.2.1| RP:SCP:REP 183->411|1a16A2|1e-63|44.1|229/264|d.127.1.1| HM:SCP:REP 1->172|2bwvA1|1.6e-28|27.1|170/0|c.55.2.1|1/1|Creatinase/prolidase N-terminal domain| HM:SCP:REP 173->416|2bwvA2|5.4e-69|43.9|244/0|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 2111 OP:NHOMOORG 1038 OP:PATTERN 11111122222222221221221112221131111111111111-----1111-21222231112-11 1253422222222121122-221111222221222212111111111122231111131132213222332111111111323112212221-1--1----2132323211111111111----1--111111-2122222111222222221--1111111111113222111111111111-111111322344444444244454422333344424443332222226322222222222222222222222323322221122221212322221122122222222222222222222222222222222222222212123444545524214114222121-121211--111211312221121211---1-11-1111111111112111211221223-11-11111-111111111233122111-211-----12111111111----------------111------------------2-121-11111111111111111111111111211121111111-1111111111111111121-------11111121211122111221111121111-1111211112122-1---12122222221111211-1-421334213222212222223222242--111111-----43111223333333333-33333333333333333332221122224222222222222222333222221112122212222-1-2212222222112111111111111-11111122111---1111111111211121111-111111111------------111121211222111111-2222222-------1--2-1111-2121111111121111221112111-111-11 ----222-21123344442333334233333333333333233333653424644334423322223332422222333332222313-333432444423326771333367343A1233252952527a4-55424-263464332425-382543344523333333-32531141V4232445563342233443 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 413 STR:RPRED 99.8 SQ:SECSTR ccHHHHHHHHHHHHHHccccEEEEEEcccccEEETTEEccccccHHHHHHHcccccccEEEEEEcccccEEEEEEccccHHHHHHHccccHHHHHHHHHTccEEEEGGGHHHHHHHHTccEEEEcTTccHHHHHHHHHHHHHHHHHTGGGTcccccEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHTTccccccccEEEEGGGGGcTTcccccccccTTcEEEEEEccEETTEEccEEEEEETTccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHHHTTcccccHHHTTTcccccccccccccccccGGcccccTTcEEEEccEEEEGGTTEEEEccEEEEEccccEEEccTTccccHHHHHHHHHH# DISOP:02AL 414-415| PSIPRED ccHHHHHHHHHHHHHHcccccEEEEEcccHHcccccccccccccccEEEEEccccccEEEEEEEcccccccEEEEEcccHHHHHHccccccHHHHHHHcccccEEEHHHHHHHHHHHHHcccccEEEccccccccccccccHHHHHHHHHHHccccEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccEEEEcccEEEccccEEEEEEEEEEEcccccEEccccccccHHHHHHHHccc //