[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2534
DDBJ      :CPE2534      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->57 PF10844 * DUF2577 0.00014 42.1 38/98  
:BLT:SWISS 2->56 SECA_PELPB 4e-04 35.3 %
:COIL
:REPEAT 2|12->33|34->55

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82240.1 GT:GENE CPE2534 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2903428..2903607 GB:FROM 2903428 GB:TO 2903607 GB:DIRECTION + GB:GENE CPE2534 GB:PRODUCT hypothetical protein GB:NOTE 59 aa, no significant homology GB:PROTEIN_ID BAB82240.1 LENGTH 59 SQ:AASEQ MNEKNLKLAQQDIDEVLKTVEELEVQIDDLSKDDLKQKFVTLTEKVRKLEDLLKDEGII GT:EXON 1|1-59:0| BL:SWS:NREP 1 BL:SWS:REP 2->56|SECA_PELPB|4e-04|35.3|51/1024| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 1->34| NREPEAT 1 REPEAT 2|12->33|34->55| HM:PFM:NREP 1 HM:PFM:REP 18->57|PF10844|0.00014|42.1|38/98|DUF2577| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-1-----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccc //