[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2536
DDBJ      :CPE2536      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   97->166 PF10110 * GPDPase_memb 2.4e-06 24.3 70/149  
:BLT:SWISS 79->210 Y610_ENCCU 2e-04 23.1 %
:PROS 56->71|PS00012|PHOSPHOPANTETHEINE
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82242.1 GT:GENE CPE2536 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2905203..2905835) GB:FROM 2905203 GB:TO 2905835 GB:DIRECTION - GB:GENE CPE2536 GB:PRODUCT hypothetical protein GB:NOTE 210 aa, no significant homology 6 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB82242.1 LENGTH 210 SQ:AASEQ MDQNINKKLSVGQFLKSVFNIFIKNLGDIAIISVLFALPTIIGRGNAIFSVIGIFSLGFSSIAIIKLANNFIRGEKVYWIETIKSAFKNPLFPLGVFLIQNFAVSLGSSIFAPLGIVISIFFVIAMQCSIFENINVIESIRKSFLLVKNNFLDILLKQFALVFIINFFTMTFAMFLNQSVLSIIIFSLVLNIITALTLIGGNLIYKEVTV GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 79->210|Y610_ENCCU|2e-04|23.1|130/100| PROS 56->71|PS00012|PHOSPHOPANTETHEINE|PDOC00012| TM:NTM 5 TM:REGION 14->36| TM:REGION 48->70| TM:REGION 100->122| TM:REGION 146->168| TM:REGION 180->202| HM:PFM:NREP 1 HM:PFM:REP 97->166|PF10110|2.4e-06|24.3|70/149|GPDPase_memb| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccc //