[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2537
DDBJ      :CPE2537      probable c-type cytochrome biogenesis protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  111/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->225 PF02683 * DsbD 2e-12 28.4 %
:HMM:PFM   22->226 PF02683 * DsbD 1.8e-31 29.1 203/211  
:BLT:SWISS 13->148 DSBD_COLP3 2e-13 30.1 %
:BLT:SWISS 126->186 DSBD_SODGM 9e-04 31.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82243.1 GT:GENE CPE2537 GT:PRODUCT probable c-type cytochrome biogenesis protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2905948..2906640) GB:FROM 2905948 GB:TO 2906640 GB:DIRECTION - GB:GENE CPE2537 GB:PRODUCT probable c-type cytochrome biogenesis protein GB:NOTE 230 aa, similar to gp:AF052290_6 putative c-type cytochrome biogenesis protein from Synechococcus PCC7002 (246 aa); 32.6% identity in 181 aa overlap. Putative N-terminal signal sequence and 6 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB82243.1 LENGTH 230 SQ:AASEQ MEFLAYFNISISNNIFLAIILSFFAGVVASFSTCTLSSIPLLIGYVQGSEVKDNKKAFKYSLIFSIGLGITFTVIGLLTALIGKAFLGAGKFWYIILAFIMIGSGLQVLDVINLFGDKKDACKITKKREGILDAFFLGILSGILASPCATPIMAAIIAFIAASGNLVIGMIMLLMYSLGHSVLIILAGTSFGLVEKIAYSENGKKIGRVLKNILGTIIILVGLYLFYLGV GT:EXON 1|1-230:0| BL:SWS:NREP 2 BL:SWS:REP 13->148|DSBD_COLP3|2e-13|30.1|136/608| BL:SWS:REP 126->186|DSBD_SODGM|9e-04|31.1|61/100| TM:NTM 7 TM:REGION 2->24| TM:REGION 29->50| TM:REGION 62->84| TM:REGION 95->117| TM:REGION 134->156| TM:REGION 168->190| TM:REGION 207->229| SEG 149->162|atpimaaiiafiaa| RP:PFM:NREP 1 RP:PFM:REP 22->225|PF02683|2e-12|28.4|201/209|DsbD| HM:PFM:NREP 1 HM:PFM:REP 22->226|PF02683|1.8e-31|29.1|203/211|DsbD| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF02683|IPR003834| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF02683|IPR003834| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02683|IPR003834| OP:NHOMO 138 OP:NHOMOORG 124 OP:PATTERN -------------------------------------11--1-------1-11--------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1-111-----------1-11-11-1---1-1-1------------------------------111------1----------------------------------------------------------------------------------------1--1-------------1-1221222212------111----11----32-1----1-111------------------------------------------------------------------1----------------------------------------------------------1------------------------------------------------------1----1-----------------1111-11-11-----112121-2------12-1--1------------------1---------1-----111111111111111111------1--------------------------------------------------------------------------------------------1-----1111-----1-11-1------------------------------------------------111-1111111111--------------11-1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11-1--11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-56, 117-131| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //