[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2538
DDBJ      :CPE2538      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->141 1w4vF PDBj 1e-04 24.7 %
:RPS:PDB   47->141 3ec3B PDBj 2e-11 8.5 %
:RPS:SCOP  26->141 2dlxA1  c.47.1.24 * 9e-14 10.8 %
:HMM:SCOP  22->140 1zmaA1 c.47.1.1 * 3.1e-17 23.4 %
:RPS:PFM   44->114 PF00085 * Thioredoxin 1e-05 31.9 %
:HMM:PFM   50->138 PF00085 * Thioredoxin 4.3e-09 22.1 86/104  
:HMM:PFM   8->90 PF11368 * DUF3169 7.6e-05 22.2 81/248  
:BLT:SWISS 37->142 BDBA_BPSPC 4e-06 25.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82244.1 GT:GENE CPE2538 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2906644..2907078) GB:FROM 2906644 GB:TO 2907078 GB:DIRECTION - GB:GENE CPE2538 GB:PRODUCT hypothetical protein GB:NOTE 144 aa, similar to pir:H70444 hypothetical protein aq_1669 from Aquifex aeolicus (164 aa); 37.4% identity in 91 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB82244.1 LENGTH 144 SQ:AASEQ MEVKNKRKLIILGLILFALIGIYIGKNYIEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANVVPTTVFLDKEGNKFYVHQGLMRKNNIETILNSLGVK GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 37->142|BDBA_BPSPC|4e-06|25.7|105/137| TM:NTM 1 TM:REGION 9->31| SEG 9->25|liilglilfaligiyig| BL:PDB:NREP 1 BL:PDB:REP 54->141|1w4vF|1e-04|24.7|85/108| RP:PDB:NREP 1 RP:PDB:REP 47->141|3ec3B|2e-11|8.5|94/224| RP:PFM:NREP 1 RP:PFM:REP 44->114|PF00085|1e-05|31.9|69/103|Thioredoxin| HM:PFM:NREP 2 HM:PFM:REP 50->138|PF00085|4.3e-09|22.1|86/104|Thioredoxin| HM:PFM:REP 8->90|PF11368|7.6e-05|22.2|81/248|DUF3169| GO:PFM:NREP 1 GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00085|IPR013766| RP:SCP:NREP 1 RP:SCP:REP 26->141|2dlxA1|9e-14|10.8|111/147|c.47.1.24| HM:SCP:REP 22->140|1zmaA1|3.1e-17|23.4|111/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 81.9 SQ:SECSTR ##########################cEEEcEEcTTccEEEHHHHHcccEEEEEEcccccTTTHHHHHHHHHHHHHHHTTcTTHcEEEEEETTTTHHHHHHTTTTTcccccEEEEEcTTccEEEccccccHHHHHHHHHHHTcH DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHccHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHcccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHccc //