[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2547
DDBJ      :CPE2547      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82253.1 GT:GENE CPE2547 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2917577..2917891) GB:FROM 2917577 GB:TO 2917891 GB:DIRECTION - GB:GENE CPE2547 GB:PRODUCT hypothetical protein GB:NOTE 104 aa, no significant homology GB:PROTEIN_ID BAB82253.1 LENGTH 104 SQ:AASEQ MIKAIVIPTPKRLKNYIRDTDFKKKAKSFVTPERAIIYGTIGTGVTIMSLSDVPAKPFVIGSLLYHGIAYEILEKWYDEYGNDEELREMMMQNRDYWNNFYMRF GT:EXON 1|1-104:0| SEG 36->47|iiygtigtgvti| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-39,81-81,87-88,90-90| PSIPRED ccEEEEEccHHHHHHHHHccHHHHHHHHHcccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHccc //