[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2549
DDBJ      :CPE2549      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.349.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->114 2jovA PDBj 3e-07 32.4 %
:RPS:SCOP  46->115 2jovA1  d.349.1.1 * 5e-09 31.4 %
:RPS:PFM   32->112 PF07892 * DUF1667 9e-18 56.8 %
:HMM:PFM   31->111 PF07892 * DUF1667 8.6e-36 54.3 81/82  
:BLT:SWISS 15->75 RS4_PROMS 1e-04 26.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82255.1 GT:GENE CPE2549 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2919593..2919940) GB:FROM 2919593 GB:TO 2919940 GB:DIRECTION - GB:GENE CPE2549 GB:PRODUCT conserved hypothetical protein GB:NOTE 115 aa, similar to pir:G72254 hypothetical protein from Thermotoga maritima (strain MSB8) (138 aa); 39.5% identity in 114 aa overlap GB:PROTEIN_ID BAB82255.1 LENGTH 115 SQ:AASEQ MVKELICIVCPRGCHLTVDTELEKVTGNTCKRGEIYGLNEVKNPTRIVTSTVKIDGCDNIVVPVKTEEPIPKGMIFDVMKEINKASVKLPIKVGDVIIEDVLGTGVSIVSAKTVS GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 15->75|RS4_PROMS|1e-04|26.2|61/202| BL:PDB:NREP 1 BL:PDB:REP 47->114|2jovA|3e-07|32.4|68/85| RP:PFM:NREP 1 RP:PFM:REP 32->112|PF07892|9e-18|56.8|81/82|DUF1667| HM:PFM:NREP 1 HM:PFM:REP 31->111|PF07892|8.6e-36|54.3|81/82|DUF1667| RP:SCP:NREP 1 RP:SCP:REP 46->115|2jovA1|5e-09|31.4|70/77|d.349.1.1| OP:NHOMO 73 OP:NHOMOORG 58 OP:PATTERN --1-1------------------------1------------------------11-1111------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------111212222222121--11211122-1---1--------1---111211-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2---------------------------1111112111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 59.1 SQ:SECSTR ##############################################EEEEEEEEccccccEEEEEEEEEEcHHHHHHHHHHHTTcEEcccccccEEEEEcTTccccEEEEcccc# DISOP:02AL 115-116| PSIPRED ccEEEEEEEcccccEEEEEEEEEEEEccccccHHHHHHHHHHcccEEEEEEEEEccccccEEEEEccccccHHHHHHHHHHHHHcEEcccccccHHHHHHHHcccccEEEEEEcc //