[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2583
DDBJ      :CPE2583      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->61 PF09552 * RE_BstXI 0.00062 24.4 45/287  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82289.1 GT:GENE CPE2583 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2958849..2959076 GB:FROM 2958849 GB:TO 2959076 GB:DIRECTION + GB:GENE CPE2583 GB:PRODUCT hypothetical protein GB:NOTE 75 aa, no significant homology Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB82289.1 LENGTH 75 SQ:AASEQ MELFSLPPDQLNLLCILIAKDYSTRYNADELNVLGDFLIALGSNIVVYSASFSYFDNLRAQSNNSINNSNNINKD GT:EXON 1|1-75:0| SEG 62->73|snnsinnsnnin| HM:PFM:NREP 1 HM:PFM:REP 17->61|PF09552|0.00062|24.4|45/287|RE_BstXI| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 61-75| PSIPRED ccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHcccccccccccccccccc //