[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2588
DDBJ      :CPE2588      peptide methionine sulfoxide reductase
Swiss-Prot:MSRA_CLOPE   RecName: Full=Peptide methionine sulfoxide reductase msrA;         Short=Protein-methionine-S-oxide reductase;         EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase;         Short=Peptide Met(O) reductase;

Homologs  Archaea  31/68 : Bacteria  782/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->156 3bqeA PDBj 4e-48 52.3 %
:RPS:PDB   1->154 3e0mC PDBj 2e-58 53.3 %
:RPS:SCOP  1->154 1ff3A  d.58.28.1 * 2e-64 42.2 %
:HMM:SCOP  1->154 1ff3A_ d.58.28.1 * 5.9e-65 55.2 %
:RPS:PFM   7->153 PF01625 * PMSR 2e-46 57.8 %
:HMM:PFM   2->155 PF01625 * PMSR 4.1e-65 54.5 154/156  
:BLT:SWISS 1->157 MSRA_CLOPE 6e-92 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82294.1 GT:GENE CPE2588 GT:PRODUCT peptide methionine sulfoxide reductase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2964045..2964518 GB:FROM 2964045 GB:TO 2964518 GB:DIRECTION + GB:GENE CPE2588 GB:PRODUCT peptide methionine sulfoxide reductase GB:NOTE 157 aa, similar to sp:PMSR_MYCGE PUTATIVE PEPTIDE METHIONINE SULFOXIDE REDUCTASE (PEPTIDE MET(O) REDUCTASE) from Mycoplasma genitalium (157 aa); 59.9% identity in 157 aa overlap GB:PROTEIN_ID BAB82294.1 LENGTH 157 SQ:AASEQ MKKIILAGGCFWGVEEFLSRINGVVSTEVGYANGRTENPTYEDICTKNTYFAEVCLVNYDENIISLKELLAKFWTIIDPTSLNKQGNDVGSQYRTGIYYVDSSDLEDILNSKEELQKSYSKKIVTEVKPLENYYKAEEYHQKYLKKNPNGYCHIKLD GT:EXON 1|1-157:0| SW:ID MSRA_CLOPE SW:DE RecName: Full=Peptide methionine sulfoxide reductase msrA; Short=Protein-methionine-S-oxide reductase; EC=1.8.4.11;AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; SW:GN Name=msrA; OrderedLocusNames=CPE2588; SW:KW Complete proteome; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|MSRA_CLOPE|6e-92|100.0|157/157| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 2->156|3bqeA|4e-48|52.3|155/169| RP:PDB:NREP 1 RP:PDB:REP 1->154|3e0mC|2e-58|53.3|152/313| RP:PFM:NREP 1 RP:PFM:REP 7->153|PF01625|2e-46|57.8|147/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 2->155|PF01625|4.1e-65|54.5|154/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 1->154|1ff3A|2e-64|42.2|154/211|d.58.28.1| HM:SCP:REP 1->154|1ff3A_|5.9e-65|55.2|154/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1512 OP:NHOMOORG 996 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241242--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323333333333333112122321-133112211111222211122222112222222222222222222222222112221111-11111112222-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122231111122222222111122421111112231213-11111111121212112221111-111111111221111112112111111111122121111212111111111111111111111111-11211112121422432322223242222222222--12111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122222222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1B12232221111111121111461-2141111111111111-1111111122111211-3221-1121456X3342353461677442229 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHccHTcEEEEEEEEETTTccHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHHHHHccccccEEEEcccEEEccTTTTTHHHHcTTcccccTTT DISOP:02AL 157-158| PSIPRED ccEEEEEEEEHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHcccccEEEEEEEEEccccccHHHHHHHHHHcccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHcccccccEEcc //