[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2627
DDBJ      :CPE2627      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  545/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->74 3by6E PDBj 6e-07 35.4 %
:BLT:PDB   92->238 2p19C PDBj 1e-11 30.3 %
:RPS:PDB   10->238 3eetA PDBj 4e-38 18.8 %
:RPS:SCOP  10->75 1e2xA1  a.4.5.6 * 2e-19 31.8 %
:RPS:SCOP  84->238 2ooiA1  d.190.1.2 * 4e-33 13.6 %
:HMM:SCOP  1->75 1v4rA1 a.4.5.6 * 2.4e-20 44.0 %
:HMM:SCOP  82->238 2fa1A1 d.190.1.2 * 1.7e-44 36.5 %
:RPS:PFM   13->73 PF00392 * GntR 1e-08 49.2 %
:RPS:PFM   96->232 PF07702 * UTRA 2e-21 37.2 %
:HMM:PFM   95->233 PF07702 * UTRA 1.3e-40 33.8 139/141  
:HMM:PFM   10->73 PF00392 * GntR 4.9e-22 51.6 64/64  
:BLT:SWISS 9->236 YBGA_BACSU 2e-39 38.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82333.1 GT:GENE CPE2627 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(3002476..3003201) GB:FROM 3002476 GB:TO 3003201 GB:DIRECTION - GB:GENE CPE2627 GB:PRODUCT probable transcriptional regulator GB:NOTE 241 aa, similar to gpu:AP001508_142 transcriptional regulator (GntR family) from Bacillus halodurans (240 aa); 36% identity in 239 aa overlap GntR family GB:PROTEIN_ID BAB82333.1 LENGTH 241 SQ:AASEQ MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKGTFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVPMMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIERVTFENERVIEYTVSVSRGDKFEYTVVLEED GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 9->236|YBGA_BACSU|2e-39|38.7|225/235| BL:PDB:NREP 2 BL:PDB:REP 10->74|3by6E|6e-07|35.4|65/124| BL:PDB:REP 92->238|2p19C|1e-11|30.3|145/148| RP:PDB:NREP 1 RP:PDB:REP 10->238|3eetA|4e-38|18.8|224/238| RP:PFM:NREP 2 RP:PFM:REP 13->73|PF00392|1e-08|49.2|61/64|GntR| RP:PFM:REP 96->232|PF07702|2e-21|37.2|137/141|UTRA| HM:PFM:NREP 2 HM:PFM:REP 95->233|PF07702|1.3e-40|33.8|139/141|UTRA| HM:PFM:REP 10->73|PF00392|4.9e-22|51.6|64/64|GntR| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| GO:PFM GO:0003677|"GO:DNA binding"|PF07702|IPR011663| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF07702|IPR011663| GO:PFM GO:0045449|"GO:regulation of transcription"|PF07702|IPR011663| RP:SCP:NREP 2 RP:SCP:REP 10->75|1e2xA1|2e-19|31.8|66/73|a.4.5.6| RP:SCP:REP 84->238|2ooiA1|4e-33|13.6|154/157|d.190.1.2| HM:SCP:REP 1->75|1v4rA1|2.4e-20|44.0|75/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->238|2fa1A1|1.7e-44|36.5|156/0|d.190.1.2|1/1|Chorismate lyase-like| OP:NHOMO 1827 OP:NHOMOORG 547 OP:PATTERN -------------------------------------------------------------------- -21283132231--23311-14--2711111263431686311-132--122523--3--21123553562-------3---4-------1--------------1-111-----------------------------1----------11----------------1--------------432-----1375555556625555556666485553573546799A98141111111111111111--11965238238386833645385342211115333333333333333334444344444443355111555425-492222222425381134443121-2----67-2--41-11211113-1-322--------232--1---1144444443447---2--2-213--844345355678311111322114332--------2--1--11-------------------------------1-1-266248888884656677A866664597BA9851155312212323354322111142----------111-12---11-----3------1-11----1----------------------------1143112-114131111-11111111111111------1------54531525554542466-55565326565444454446663421-5345454555455555454334452-333243333344---1-----------435---1-----------5545421-12-16656444523324-344---------122212221234422-122221222-------1-------------------------------------------231-15-1-1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------9-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 99.2 SQ:SECSTR HccccccccHHHHHHHHHHHHHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEccccEEEcccccccccHHHHHcccTTccEEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEEEETTEEEEEEEEEHHHHTTccTTcTTccTTTTHHHHHTTccccEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEETTEEEEEEEEEEETTTEEEEcccc## DISOP:02AL 1-9| PSIPRED cccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEccccHHHHHHHHccHHHHHHHHccccEEEEEEEEEEcccHHHHHHHccccccHHHHHHHHHHHcccEEEEEEEEccHHHcccccHHHHccccHHHHHHHHccccEEEEEEEEEEEEccHHHHHHHcccccccEEEEEEEEEEccEEEEEEEEEEcccEEEEEEEEEcc //