[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2649
DDBJ      :CPE2649      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:196 amino acids
:PSIPRED
:HMM:SCOP  11->179 1c8bA_ c.56.1.2 * 3.5e-43 39.1 %
:RPS:PFM   11->170 PF06866 * DUF1256 4e-48 58.2 %
:HMM:PFM   7->172 PF06866 * DUF1256 1.3e-70 57.1 163/164  
:BLT:SWISS 6->173 YYAC_BACSU 5e-44 50.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82355.1 GT:GENE CPE2649 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 3020949..3021539 GB:FROM 3020949 GB:TO 3021539 GB:DIRECTION + GB:GENE CPE2649 GB:PRODUCT conserved hypothetical protein GB:NOTE 196 aa, similar to gpu:AP001520_278 BH4054 gene product from Bacillus halodurans (216 aa); 49.7% identity in 169 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB82355.1 LENGTH 196 SQ:AASEQ MCTSFYINSLDPKASFKIRDYLCRELSPVIKENRPIVFICIGSDRSTGDALGPLIGEKIKFLSKNNIFIYGTLEETVHAGNLKETVKIIKSKHKKPFIIAIDACLGAVDNVGHVLIEKRPLKPGIALNKDLPEVGDLSILGIVNISGSLEFMVLQNTRLYTVMLLANAISNGIHHCILKSVGFKKNILDSTLENIL GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 6->173|YYAC_BACSU|5e-44|50.6|166/205| RP:PFM:NREP 1 RP:PFM:REP 11->170|PF06866|4e-48|58.2|158/165|DUF1256| HM:PFM:NREP 1 HM:PFM:REP 7->172|PF06866|1.3e-70|57.1|163/164|DUF1256| HM:SCP:REP 11->179|1c8bA_|3.5e-43|39.1|169/0|c.56.1.2|1/1|HybD-like| OP:NHOMO 111 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111222-111------12-------------------------------------------------------------------------------------------2132222223223211222222122--2--111121221111222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEcHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEccccccEEccHHHHHHHHHHHccccEEEEEEEcccccccccEEEEccccccccccccccccccccEEEEEEEEcccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccc //