[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE2658
DDBJ      :CPE2658      conserved hypothetical protein
Swiss-Prot:Y2995_CLOP1  RecName: Full=UPF0161 protein CPF_2995;

Homologs  Archaea  0/68 : Bacteria  695/915 : Eukaryota  21/199 : Viruses  1/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:RPS:PFM   2->68 PF01809 * DUF37 2e-21 67.2 %
:HMM:PFM   1->68 PF01809 * DUF37 8.9e-36 57.4 68/68  
:BLT:SWISS 1->69 Y2995_CLOP1 1e-39 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82364.1 GT:GENE CPE2658 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(3030056..3030265) GB:FROM 3030056 GB:TO 3030265 GB:DIRECTION - GB:GENE CPE2658 GB:PRODUCT conserved hypothetical protein GB:NOTE 69 aa, similar to pir:G72251 conserved hypothetical protein from Thermotoga maritima (strain MSB8) (81 aa); 63.2% identity in 68 aa overlap GB:PROTEIN_ID BAB82364.1 LENGTH 69 SQ:AASEQ MKKLFIVMIKFYRKYISPLKRPCCRFYPTCSQYALEAIQKYGAFKGGFMSIGRILRCNPFCKGGYDPVK GT:EXON 1|1-69:0| SW:ID Y2995_CLOP1 SW:DE RecName: Full=UPF0161 protein CPF_2995; SW:GN OrderedLocusNames=CPF_2995; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->69|Y2995_CLOP1|1e-39|100.0|69/69| RP:PFM:NREP 1 RP:PFM:REP 2->68|PF01809|2e-21|67.2|67/68|DUF37| HM:PFM:NREP 1 HM:PFM:REP 1->68|PF01809|8.9e-36|57.4|68/68|DUF37| OP:NHOMO 741 OP:NHOMOORG 717 OP:PATTERN -------------------------------------------------------------------- 11111--1-1-1-1-1112-11--111111111111-11111--111111111111111111111111111----1-11111111111111111111--111111111111111111111111111111111111111111---113111111111111111111111111111111111111111111111111111111111111111122111-111-111111111111-111111111111-1111111-111111111111-11111---1111111111111111111111111111111111111---1111111111111111111-1-111111111-111111111-1--11111111111211-111-111111-1111111111111111111111---1-----111--11-1-----1111---1111111111--------1-1-11-1--------11--11111-111-111----11111-11111111111111111111111111111111111--1111111111111121111111111111111111-121-1112-1111---111111211111111111-11111111---------1-1-11111-1111111111111111111111-1111-111-11-------11-1-1---11---1--11---1111-111111111----111--11--1---1-1-1-11-1---11-----111-1-11--1111111111-11-111111-1-1111111111111111111111111-1-21-1-1111111111--11----1-1-1--1--1111111-1-11111111111111--------1---------------------------111-111111111 ------------------------------------------------------------------------------------------------------------2-------------------------------------------------------------4---111116111111231-1111----- -----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccc //