[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : acdS
DDBJ      :acdS         acyl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  581/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:378 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->378 1bucA PDBj 3e-97 48.7 %
:RPS:PDB   1->378 1egcA PDBj e-107 35.4 %
:RPS:SCOP  1->227 1rx0A2  e.6.1.1 * 2e-68 36.3 %
:RPS:SCOP  228->378 1bucA1  a.29.3.1 * 2e-48 62.9 %
:HMM:SCOP  2->241 1w07A3 e.6.1.2 * 2.9e-77 48.8 %
:HMM:SCOP  228->378 1bucA1 a.29.3.1 * 3.8e-54 49.7 %
:RPS:PFM   15->117 PF02771 * Acyl-CoA_dh_N 6e-18 40.8 %
:RPS:PFM   121->172 PF02770 * Acyl-CoA_dh_M 1e-12 53.8 %
:RPS:PFM   228->376 PF00441 * Acyl-CoA_dh_1 1e-37 51.0 %
:HMM:PFM   228->373 PF00441 * Acyl-CoA_dh_1 9e-53 49.3 146/150  
:HMM:PFM   6->117 PF02771 * Acyl-CoA_dh_N 3e-30 46.4 112/113  
:HMM:PFM   121->172 PF02770 * Acyl-CoA_dh_M 6.7e-21 46.2 52/52  
:BLT:SWISS 1->378 ACDS_CLOAB e-130 58.5 %
:PROS 123->135|PS00072|ACYL_COA_DH_1
:PROS 335->354|PS00073|ACYL_COA_DH_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79803.1 GT:GENE acdS GT:PRODUCT acyl-CoA dehydrogenase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 133724..134860 GB:FROM 133724 GB:TO 134860 GB:DIRECTION + GB:GENE acdS GB:PRODUCT acyl-CoA dehydrogenase GB:NOTE 378 aa, similar to sp:ACDS_CLOAB ACYL-COA DEHYDROGENASE, SHORT-CHAIN SPECIFIC (EC 1.3.99.2) (SCAD) (BUTYRYL-COA DEHYDROGENASE) from Clostridium acetobutylicum (379 aa); 58.5% identity in 378 aa overlap. 1 putative transmembrane region was found by PSORT CPE0097 GB:PROTEIN_ID BAB79803.1 LENGTH 378 SQ:AASEQ MDFSLTQKQLDVQRAVKEFAERELKPFAIENDENSTFPIEAYKKLGELGVIGLPYSTEYGGTGGDYLSYVLAIEEISKVDASMGIAVSVTTSLCAGGISNASEELKKKYLPDILSGKKLGSFGLTEPNAGSDAGGVITVAEKKGDNYILNGAKCFITNAPLSGTFIVFALTDRTKGPKGLSAFIVEKDFPGISIGKIEDKCGIKSAQVSEVLFNDCVVPASNLVGKEGDGFKIAMKTLDGGRIGVAAQGLGIAEGAFEIAKEYMKERKQFGKPLFKQQYLAFKMAELAVEIEQAKYMLYKAAMDKQEGKPYSVSAAKAKLVCTDAAMHVTTEAIQMLGGNGYMREYQLERMMRDAKITQIYEGTNEIQKLIISGSLFR GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 1->378|ACDS_CLOAB|e-130|58.5|378/379| PROS 123->135|PS00072|ACYL_COA_DH_1|PDOC00070| PROS 335->354|PS00073|ACYL_COA_DH_2|PDOC00070| BL:PDB:NREP 1 BL:PDB:REP 1->378|1bucA|3e-97|48.7|378/383| RP:PDB:NREP 1 RP:PDB:REP 1->378|1egcA|e-107|35.4|378/387| RP:PFM:NREP 3 RP:PFM:REP 15->117|PF02771|6e-18|40.8|103/113|Acyl-CoA_dh_N| RP:PFM:REP 121->172|PF02770|1e-12|53.8|52/53|Acyl-CoA_dh_M| RP:PFM:REP 228->376|PF00441|1e-37|51.0|149/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 228->373|PF00441|9e-53|49.3|146/150|Acyl-CoA_dh_1| HM:PFM:REP 6->117|PF02771|3e-30|46.4|112/113|Acyl-CoA_dh_N| HM:PFM:REP 121->172|PF02770|6.7e-21|46.2|52/52|Acyl-CoA_dh_M| GO:PFM:NREP 6 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02770|IPR006091| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02770|IPR006091| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 1->227|1rx0A2|2e-68|36.3|226/231|e.6.1.1| RP:SCP:REP 228->378|1bucA1|2e-48|62.9|151/151|a.29.3.1| HM:SCP:REP 2->241|1w07A3|2.9e-77|48.8|240/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 228->378|1bucA1|3.8e-54|49.7|151/151|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 7679 OP:NHOMOORG 784 OP:PATTERN 55----6888A88977-243532DA6661-7C-----------------------------5771--- 4556Y4-5111846b*qRR-Ro44oxRRRRRYvu*ucr**4kAo2135-11-667669--IEX1HHWOKOF--------384B-----11111122---41545664565--------------------------676A9---D312-1112--------------123-------------88878--1F746666646666666664566656667DAAB11------54-22222212222212211-2--1------------------------------------------------------------------111315444444444423222221-6-316-13-B91598-17---11-3-71-TLLW-----61aOU665THURLAA9A9AA7978-44C55H4CCCZ1999975777889AIAUBADF7777D9J21222222B----9C6-----------------------------1MOZN18VKDSEDFJSEDBGGECCPGKKKKCJTEaawrm35HIDC6FHHPGMNTd34A-1--66--11111212I884lIM-----------765-B-5--8898DC66----1-------1--------1-----54-AG497HC1676666AF6666B6F8688---211-------42721214445455444-444444443444444444322211112544245544353533522333233--222232212232---6222228888-LE43-----------1---KJLGKDK8BAA2QQQRBOFJKGDFFHA89111111111-111422222462447766666566------12CCA9BB----------1-------------------------1--11-1------ ----BAA-942-AAAEBCBC9A9B8ACCC8A9A888AA9A8AABCC97789ACF8A7867775-1-1--1--1-1------1--11---8B7B8876566999DCD-B78JEXCBGFA999AD9JC6J9W*E-FBQ8A97F8AJB49B89D84HADBBQAGI7JDG8D9DFGLFH2343Z43365867KB4664GAA9B ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 100.0 SQ:SECSTR ccccccHHHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHHHHHHHHHTcccTTccTTTTcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTccccEEEEcccTTccccGGGcccEEEEcccEEEEEEEEEEEETGGGccEEEEEEEcTTccHHHHEEEEEEETTcTTEEEcccccccccTTccEEEEEEEEEEEEGGGccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccccccGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGGcTTcHHHHHHHHHGGGGTTTccHHHHHHHHHHHHHH PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEEcccccccccHHHcEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEcccccccccEEEEEEEcccccEEEEcccccccccccccEEEEEccEEccHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcc //