[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : argG
DDBJ      :argG         argininosuccinate synthase
Swiss-Prot:ASSY_CLOPE   RecName: Full=Argininosuccinate synthase;         EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase;

Homologs  Archaea  56/68 : Bacteria  757/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.26.2d.210.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->392 1vl2C PDBj e-107 51.2 %
:RPS:PDB   8->364 2deuA PDBj 2e-47 14.8 %
:RPS:SCOP  8->170 1j1zA1  c.26.2.1 * 1e-73 58.3 %
:RPS:SCOP  178->403 1k92A2  d.210.1.1 * 7e-58 29.3 %
:HMM:SCOP  6->170 1vl2A1 c.26.2.1 * 4.5e-49 43.3 %
:HMM:SCOP  177->402 1korA2 d.210.1.1 * 4.8e-87 56.4 %
:RPS:PFM   10->392 PF00764 * Arginosuc_synth e-142 63.1 %
:HMM:PFM   10->397 PF00764 * Arginosuc_synth 5.8e-153 53.4 386/390  
:BLT:SWISS 1->405 ASSY_CLOPE 0.0 100.0 %
:PROS 12->20|PS00564|ARGININOSUCCIN_SYN_1
:PROS 120->131|PS00565|ARGININOSUCCIN_SYN_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80397.1 GT:GENE argG GT:PRODUCT argininosuccinate synthase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(860568..861785) GB:FROM 860568 GB:TO 861785 GB:DIRECTION - GB:GENE argG GB:PRODUCT argininosuccinate synthase GB:NOTE 405 aa, similar to pir:T06667 argininosuccinate synthase (EC 6.3.4.5) from Arabidopsis thaliana (498 aa); 53.5% identity in 396 aa overlap CPE0691 GB:PROTEIN_ID BAB80397.1 LENGTH 405 SQ:AASEQ MYMKKFNKVILAYSGGLDTSIIIPWLKENYGCEVIAVVGNVGQSDELVGLKEKAIKTGASKIYIEDLTKEFVEDYIFPTIQAGAKYEGKYLLGTSFARPIIAKRLVEIAKLEGADAICHGCTGKGNDQVRFELAIKTFNPEMQIIAPWRTWEIKSREEEIQYAIDNEVPINITYETNYSKDKNLWHLSHEGLDLEFPENEPKYDKILELCNTLEKAPNEAEYITLGFEKGIATSLNGEKLDGVTLLQELNKIGGKHGIGVIDMVENRLVGMKSRGVYETPGGSILYKAHKDLEELCLDKETSHYKEIVSLKFADLVYNGQWFTPLREALSAFISKTQETVTGEIKLKLYKGNIINAGMTSPYSLYSEEYATFGEDGIYNQKDAEGFINLFSLPSIVQAKMAQKLN GT:EXON 1|1-405:0| SW:ID ASSY_CLOPE SW:DE RecName: Full=Argininosuccinate synthase; EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase; SW:GN Name=argG; OrderedLocusNames=CPE0691; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->405|ASSY_CLOPE|0.0|100.0|405/405| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 12->20|PS00564|ARGININOSUCCIN_SYN_1|PDOC00488| PROS 120->131|PS00565|ARGININOSUCCIN_SYN_2|PDOC00488| BL:PDB:NREP 1 BL:PDB:REP 8->392|1vl2C|e-107|51.2|375/393| RP:PDB:NREP 1 RP:PDB:REP 8->364|2deuA|2e-47|14.8|330/364| RP:PFM:NREP 1 RP:PFM:REP 10->392|PF00764|e-142|63.1|382/390|Arginosuc_synth| HM:PFM:NREP 1 HM:PFM:REP 10->397|PF00764|5.8e-153|53.4|386/390|Arginosuc_synth| GO:PFM:NREP 3 GO:PFM GO:0004055|"GO:argininosuccinate synthase activity"|PF00764|IPR001518| GO:PFM GO:0005524|"GO:ATP binding"|PF00764|IPR001518| GO:PFM GO:0006526|"GO:arginine biosynthetic process"|PF00764|IPR001518| RP:SCP:NREP 2 RP:SCP:REP 8->170|1j1zA1|1e-73|58.3|163/165|c.26.2.1| RP:SCP:REP 178->403|1k92A2|7e-58|29.3|225/256|d.210.1.1| HM:SCP:REP 6->170|1vl2A1|4.5e-49|43.3|164/0|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 177->402|1korA2|4.8e-87|56.4|225/225|d.210.1.1|1/1|Argininosuccinate synthetase, C-terminal domain| OP:NHOMO 1104 OP:NHOMOORG 988 OP:PATTERN ---1-11111111111-1111111111111111111111111111111111111-1-----1111-11 1111111111111111111-11111111111111111111111111111111111111--121111121211111111--11111111111111---111-1-1111111---------------11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111----11-1---111111-1-111111111----111111111--1-1-------------111111111111-1111111111111111111-1111-1111111111-11111111--1111111111--1111111111111111111111111-1121111111112112121222111111111111111111111111111111111---11111---------------------11111111111111111111111111222221111111111111111111111111111111111111111111111-111111111111111111111111111112111111111111-1-------1111111111111111111111111111111111111-1-111111111111111111111111111-111111111111111111111111221111111111111111111111111--111111111111---1-----111111111111111111111111111111111111111111111111111111--------111111111111122111111111111111111111111-------------------------------------11--11111111 ------1-11--11111111111121111111111111111111112121222221111111-11111-1111111111111111111-11111121111121112-11-21212121111111211B1AQ2-552-1-121112-1-1-11-2131-2132131111112--11111181111111221121121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 400 STR:RPRED 98.8 SQ:SECSTR HccccccEEEEEccccHHHHHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHHHHHcEEEEcTHHHHHHHTHHHHHHHHHTTccccHHHHHcccccTTHHHHHHHTTcccccEEccEEEEcccTTcccGGGGTTccHHHHHTEEccGGGccHHHHHHHHHHHTcTTHHHccccccccccccccccHHHHHTTTccccccEcEEcccccEEEEccccTTccTTccTTccccccEEcTTcTTTcEEcccccccccEEEEETTTTEEEEEcccTTcGGGEEEEEEEccccccEEEEEEcccTTcccEEEEEEEcccccEEEEHHHHHEEEEEEEEEETccTTccccEEccccEEEccEEEcccHHHHHHHHHccccEEcccccccccTTcEEEEccccc##### DISOP:02AL 1-6, 402-405| PSIPRED cccccccEEEEEEEccccHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcccccEEEEcEEccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccHHHHEEEcccHHHcccccEEEEEEEEccEEEEEccEEccHHHHHHHHHHHHHHcccccEEEEEccEEEEEHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcEEEEEEEEEEEEcEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc //