[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : aroE
DDBJ      :aroE         shikimate 5-dehydrogenase
Swiss-Prot:AROE_CLOPE   RecName: Full=Shikimate dehydrogenase;         EC=1.1.1.25;

Homologs  Archaea  56/68 : Bacteria  693/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->251 3fbtA PDBj 4e-60 47.6 %
:RPS:PDB   1->266 2d5cA PDBj 5e-59 31.3 %
:RPS:SCOP  2->100 1npdA2  c.58.1.5 * 8e-32 37.4 %
:RPS:SCOP  101->256 1npyA1  c.2.1.7 * 3e-38 24.3 %
:HMM:SCOP  1->100 1nvtA2 c.58.1.5 * 8.3e-32 43.0 %
:HMM:SCOP  101->269 1npyA1 c.2.1.7 * 1.4e-34 37.0 %
:RPS:PFM   6->88 PF08501 * Shikimate_dh_N 4e-16 45.8 %
:RPS:PFM   115->225 PF01488 * Shikimate_DH 1e-05 30.8 %
:HMM:PFM   6->88 PF08501 * Shikimate_dh_N 4.5e-31 53.0 83/83  
:HMM:PFM   115->212 PF01488 * Shikimate_DH 3.1e-15 32.0 97/135  
:BLT:SWISS 1->271 AROE_CLOPE e-147 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80406.1 GT:GENE aroE GT:PRODUCT shikimate 5-dehydrogenase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 875075..875890 GB:FROM 875075 GB:TO 875890 GB:DIRECTION + GB:GENE aroE GB:PRODUCT shikimate 5-dehydrogenase GB:NOTE 271 aa, similar to gpu:AP001511_213 shikimate 5-dehydrogenase from Bacillus halodurans (278 aa); 40.6% identity in 256 aa overlap CPE0700 GB:PROTEIN_ID BAB80406.1 LENGTH 271 SQ:AASEQ MKLFGLIGEKLGHSLSPEIHNKVFKDNNIDGLYNLFSVKKDFENNIVESLKCLGVKGANVTIPYKEKVMDQLDIISHEAKVIGAVNTILIKDGKSYGYNTDYYGFGKMLERAKVNIEGNSFFVLGAGGAARSILKYLEDSKAKKIVLVSRDKEKAFKKFKDFNINFMSYGELEEINEEFALINTTPCGMYPNTNSVAVSEKVIKKFKVAVDIVYNPLETKFLKMAKDNGLKTVDGLFMLVGQGVKAEEIWNGIKVDKSTEEEIYEELKCRF GT:EXON 1|1-271:0| SW:ID AROE_CLOPE SW:DE RecName: Full=Shikimate dehydrogenase; EC=1.1.1.25; SW:GN Name=aroE; OrderedLocusNames=CPE0700; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|AROE_CLOPE|e-147|100.0|271/271| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 151->162|dkekafkkfkdf| BL:PDB:NREP 1 BL:PDB:REP 3->251|3fbtA|4e-60|47.6|246/272| RP:PDB:NREP 1 RP:PDB:REP 1->266|2d5cA|5e-59|31.3|259/261| RP:PFM:NREP 2 RP:PFM:REP 6->88|PF08501|4e-16|45.8|83/83|Shikimate_dh_N| RP:PFM:REP 115->225|PF01488|1e-05|30.8|104/115|Shikimate_DH| HM:PFM:NREP 2 HM:PFM:REP 6->88|PF08501|4.5e-31|53.0|83/83|Shikimate_dh_N| HM:PFM:REP 115->212|PF01488|3.1e-15|32.0|97/135|Shikimate_DH| GO:PFM:NREP 3 GO:PFM GO:0004764|"GO:shikimate 5-dehydrogenase activity"|PF01488|IPR006151| GO:PFM GO:0005737|"GO:cytoplasm"|PF01488|IPR006151| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01488|IPR006151| RP:SCP:NREP 2 RP:SCP:REP 2->100|1npdA2|8e-32|37.4|99/106|c.58.1.5| RP:SCP:REP 101->256|1npyA1|3e-38|24.3|152/167|c.2.1.7| HM:SCP:REP 1->100|1nvtA2|8.3e-32|43.0|100/110|c.58.1.5|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 101->269|1npyA1|1.4e-34|37.0|165/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1131 OP:NHOMOORG 853 OP:PATTERN ---1--1111111111-11111111--111-1111111111111111111111111-111-1111-11 113---22333----------1---1-------111-334---3-------1222--1-----1---1----------11-111111112111111-1111111111111-------1111111111111111111---111111111111111111111111111111111111111111112221111-113111111111111111111121111111111133333311111111111111111111111--1221--1-44--2-11-11-1111111111111111111111112222222222222111111111111111111111111212331111111-11121111111111111111-11-11-11111111314321111111111111111111-11111211111-1332313212221111111111111121111111112221111-----------------------------1121-1-----1111111----111------11111---11--1-----------1----11111111111111--1-1211111111111-1111111211111-111111111111111111111111111111--11-111111111111-111111-11111---1111111---11112112222222222-2222322232222222222332111-1313133333332321311222222--2222222122221-111111111111-1131111221222221121111111--13111113233-3434-222-111111111111111111111111111111---11111111111111--------1-1---------------------------1-------11- ------1-----1111231-231424311111111111-111111111226445112123331121-1---111211-111-11-111-12221111111221111---------------------------------------------------------------------111-D111-11127111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccTTccHHHHHHHHHHHTTccEEEEEEEccGGGHHHHHHHHHHHHccEEEEcTTcTTGGGGGccEEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHTTccccccEcEEEcccHHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHHTcEEccGGGGGGccGGcEEEEcccTTTTcTTccccccGGGcccccEEEEccccccccHHHHHHHHTTcEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHH DISOP:02AL 271-272| PSIPRED cEEEEEEccHHHHcccHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccHHHHHcccccEEEEEccEEEEEEcHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccccHHHHHHcccccEEEEccccccccccccccccHHHcccccEEEEEcccccccHHHHHHHHcccEEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccc //