[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : asrA.1
DDBJ      :asrA         anaerobic sulfite reductase subunit A
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  111/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.2a.102.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   221->315 1kekA PDBj 5e-05 38.6 %
:RPS:PDB   221->329 1b0tA PDBj 5e-07 12.5 %
:RPS:SCOP  45->183 1agmA  a.102.1.1 * 8e-05 5.8 %
:RPS:SCOP  221->333 1nekB1  a.1.2.1 * 4e-06 15.7 %
:HMM:SCOP  173->335 2bs2B1 a.1.2.1 * 3.4e-14 20.3 %
:RPS:PFM   237->273 PF05577 * Peptidase_S28 4e-04 37.8 %
:HMM:PFM   221->235 PF00037 * Fer4 2.5e-06 60.0 15/24  
:HMM:PFM   303->316 PF00037 * Fer4 2.2e-05 50.0 14/24  
:HMM:PFM   98->139 PF05628 * Borrelia_P13 0.00084 21.4 42/167  
:BLT:SWISS 1->333 ASRA_SALTY 1e-77 42.5 %
:PROS 223->234|PS00198|4FE4S_FER_1
:PROS 304->315|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81146.1 GT:GENE asrA.1 GT:PRODUCT anaerobic sulfite reductase subunit A GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1697955..1698971) GB:FROM 1697955 GB:TO 1698971 GB:DIRECTION - GB:GENE asrA GB:PRODUCT anaerobic sulfite reductase subunit A GB:NOTE 338 aa, similar to sp:ASRA_SALTY ANAEROBIC SULFITE REDUCTASE SUBUNIT A (ANAEROBIC SULFITE REDUCTASE IRON-SULFUR SUBUNIT) from Salmonella typhimurium (347 aa); 45.3% identity in 333 aa overlap CPE1440 GB:PROTEIN_ID BAB81146.1 LENGTH 338 SQ:AASEQ MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDFSYKEVLLPITQTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKKLREKAKFIVMGCENSFDNCFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEAVESNKEEVSPKFVEENETKVEVPEGIDLNIIKSTVWNEYSERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDKGQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNA GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 1->333|ASRA_SALTY|1e-77|42.5|332/347| PROS 223->234|PS00198|4FE4S_FER_1|PDOC00176| PROS 304->315|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 221->315|1kekA|5e-05|38.6|70/1231| RP:PDB:NREP 1 RP:PDB:REP 221->329|1b0tA|5e-07|12.5|96/106| RP:PFM:NREP 1 RP:PFM:REP 237->273|PF05577|4e-04|37.8|37/411|Peptidase_S28| HM:PFM:NREP 3 HM:PFM:REP 221->235|PF00037|2.5e-06|60.0|15/24|Fer4| HM:PFM:REP 303->316|PF00037|2.2e-05|50.0|14/24|Fer4| HM:PFM:REP 98->139|PF05628|0.00084|21.4|42/167|Borrelia_P13| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF05577|IPR008758| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF05577|IPR008758| RP:SCP:NREP 2 RP:SCP:REP 45->183|1agmA|8e-05|5.8|139/470|a.102.1.1| RP:SCP:REP 221->333|1nekB1|4e-06|15.7|89/132|a.1.2.1| HM:SCP:REP 173->335|2bs2B1|3.4e-14|20.3|133/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 149 OP:NHOMOORG 122 OP:PATTERN -----------------------------1------------------1-----221-122-111--- ------------------------11-------111-11-1-1-------------------------------------11---11-----1--------------------------------22222111211-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112-1--1221-1------11--3211-11211----1-1----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11--212111111-2221113-2-----111-------------------------111-----------------------------------1----------2----------------1-----------------------11-1111111111111-------------------------------1111------------------------------1------------------1---------------------------------------1--------------------------------------------1--------2-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 31.4 SQ:SECSTR ############################################################################################################################################################################################################################GGGTTTccHHHHcccccEEEccccEEEcTTTcccccccTTTcTTccEEEG###HHHHHHTcTTGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGGG######### DISOP:02AL 190-191, 332-338| PSIPRED ccEEccHHHHHHHHHHHHcccEEEEEEEEcccEEEcccccccccccccHHHHHHcccccccHHHEEcccccEEEEEEcccccccccccccEEEEEccHHHHHHHHHHHHHcccccccHHHHHHHHcEEEEEEEEcccccccEEEEccccccccccHHEEEccccEEEEEccHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccEEEEEEEEEEEccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccc //