[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : asrC.1
DDBJ      :asrC         anaerobic sulfite reductase subunit C
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  179/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.134.1d.58.36
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->297 3c7bA PDBj 2e-13 30.2 %
:RPS:PDB   27->221 2akjA PDBj 4e-28 17.1 %
:RPS:SCOP  22->81 1zj8A2  d.58.36.1 * 1e-17 28.3 %
:RPS:SCOP  104->213 2akjA4  d.134.1.1 * 7e-14 12.7 %
:HMM:SCOP  25->83 1aopA1 d.58.36.1 * 7.4e-12 39.0 %
:HMM:SCOP  101->305 1aopA4 d.134.1.1 * 9.7e-25 29.7 %
:RPS:PFM   22->76 PF03460 * NIR_SIR_ferr 6e-11 40.0 %
:RPS:PFM   104->163 PF01077 * NIR_SIR 1e-08 45.8 %
:RPS:PFM   199->220 PF00037 * Fer4 2e-04 63.6 %
:HMM:PFM   101->300 PF01077 * NIR_SIR 3.8e-32 29.0 138/157  
:HMM:PFM   21->81 PF03460 * NIR_SIR_ferr 9.2e-22 36.1 61/69  
:BLT:SWISS 1->318 ASRC_SALTY 2e-80 44.4 %
:PROS 206->217|PS00198|4FE4S_FER_1
:PROS 145->161|PS00365|NIR_SIR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81144.1 GT:GENE asrC.1 GT:PRODUCT anaerobic sulfite reductase subunit C GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1696177..1697157) GB:FROM 1696177 GB:TO 1697157 GB:DIRECTION - GB:GENE asrC GB:PRODUCT anaerobic sulfite reductase subunit C GB:NOTE 326 aa, similar to sp:ASRC_SALTY ANAEROBIC SULFITE REDUCTASE SUBUNIT C (EC 1.8.1.-) from Salmonella typhimurium (337 aa); 43.4% identity in 318 aa overlap CPE1438 GB:PROTEIN_ID BAB81144.1 LENGTH 326 SQ:AASEQ MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDMKDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHFKIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCGECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGKEHIGYIIDRTGFMEFKKWALEGVTLSEKALMKNNVYWSGIHYTNGF GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 1->318|ASRC_SALTY|2e-80|44.4|313/337| PROS 206->217|PS00198|4FE4S_FER_1|PDOC00176| PROS 145->161|PS00365|NIR_SIR|PDOC00314| BL:PDB:NREP 1 BL:PDB:REP 27->297|3c7bA|2e-13|30.2|258/417| RP:PDB:NREP 1 RP:PDB:REP 27->221|2akjA|4e-28|17.1|187/535| RP:PFM:NREP 3 RP:PFM:REP 22->76|PF03460|6e-11|40.0|55/67|NIR_SIR_ferr| RP:PFM:REP 104->163|PF01077|1e-08|45.8|59/153|NIR_SIR| RP:PFM:REP 199->220|PF00037|2e-04|63.6|22/24|Fer4| HM:PFM:NREP 2 HM:PFM:REP 101->300|PF01077|3.8e-32|29.0|138/157|NIR_SIR| HM:PFM:REP 21->81|PF03460|9.2e-22|36.1|61/69|NIR_SIR_ferr| GO:PFM:NREP 8 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03460|IPR005117| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03460|IPR005117| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01077|IPR006067| GO:PFM GO:0020037|"GO:heme binding"|PF01077|IPR006067| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01077|IPR006067| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01077|IPR006067| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00037|IPR001450| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00037|IPR001450| RP:SCP:NREP 2 RP:SCP:REP 22->81|1zj8A2|1e-17|28.3|60/152|d.58.36.1| RP:SCP:REP 104->213|2akjA4|7e-14|12.7|110/171|d.134.1.1| HM:SCP:REP 25->83|1aopA1|7.4e-12|39.0|59/0|d.58.36.1|1/1|Sulfite reductase, domains 1 and 3| HM:SCP:REP 101->305|1aopA4|9.7e-25|29.7|138/145|d.134.1.1|1/1|Sulfite reductase hemoprotein (SiRHP), domains 2 and 4| OP:NHOMO 253 OP:NHOMOORG 210 OP:PATTERN -----------------1322111---------112221----24121-21112-------------- --------------------------------------1------------------------------------------------------1-----------1---------------------1----11----------1-111-11-11--1-1---2---111----1-----1---1------------------------------------------------1111111111111111111-----------------------------------------------------------------------1-1132222222223-2112221221---11--33112---2311-1--1---1111----------111-------------------------1----111111-1111--11-11-----1--------------11---------------------------------111-----1-------1111----111111--------1---111---11121-111--1-----------1--1-111-111--111--111-1111--------1---------------------------1---------------------------------------------------------------1-----------------------1111111111111111-------------------------------------1---------------------------1-1111--1-1----1-----------------------------------------11--------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111-1-------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 88.3 SQ:SECSTR ##################ccTTEEEEEcccGGGEEEHHHHHHHHHHHHTTGGccEEEcTTccEEEEEEcGGGHHHHHHGHHHHHHHHHTTTcccTTcccccHcccccccTTTTTcTTcccccHHHHHHHHHHHTTTTTcccEEEcccTTcTTcGGGccEEEEEEEccccEEEEEEEccEEccEEccEEEEEEEEGGGHHHHHHHHHHHHHHHcccccGGGcEETTETTTccHHHHHHHHHHHHHHcccEEEcTTccEEEcGGGHHHHHHHHHHHHHHHHHHHTTccccccccccccEEHHHTcccc#################### DISOP:02AL 1-2| PSIPRED ccccccHHHHHccccEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHcccHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccEEccccEEEEcccccEEcccHHHHccccccccccccEEEEEEEccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccc //