[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : atpF
DDBJ      :atpF         ATP synthase B chain
Swiss-Prot:ATPF_CLOPE   RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b;         Short=F-ATPase subunit b;AltName: Full=ATPase subunit I;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.23.21
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  63->123 1l2pA_ f.23.21.1 * 3.3e-06 42.6 %
:HMM:PFM   9->137 PF00430 * ATP-synt_B 5.9e-27 31.0 129/132  
:BLT:SWISS 1->159 ATPF_CLOPE 3e-63 100.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81897.1 GT:GENE atpF GT:PRODUCT ATP synthase B chain GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2512659..2513138) GB:FROM 2512659 GB:TO 2513138 GB:DIRECTION - GB:GENE atpF GB:PRODUCT ATP synthase B chain GB:NOTE 159 aa, similar to sp:ATPF_CLOAB ATP SYNTHASE B CHAIN (EC 3.6.1.34) from Clostridium acetobutylicum (159 aa); 38% identity in 137 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE2191 GB:PROTEIN_ID BAB81897.1 LENGTH 159 SQ:AASEQ MEIDFMRILATIINFIILILILKHFFWDKIKRAIDARQEAIDETILKADEDAEKARRLRLDNERILKSAKEEGRKLREEQKKEADRIYKEIVDDAHREAEAIINRANIEIQREEEKVKYELKQQVVDISVMLSEKALGESIDESKHRELINDFIEKVGI GT:EXON 1|1-159:0| SW:ID ATPF_CLOPE SW:DE RecName: Full=ATP synthase subunit b;AltName: Full=ATP synthase F(0) sector subunit b;AltName: Full=F-type ATPase subunit b; Short=F-ATPase subunit b;AltName: Full=ATPase subunit I; SW:GN Name=atpF; OrderedLocusNames=CPE2191; SW:KW ATP synthesis; Cell membrane; CF(0); Complete proteome;Hydrogen ion transport; Ion transport; Membrane; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->159|ATPF_CLOPE|3e-63|100.0|159/159| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| COIL:NAA 70 COIL:NSEG 2 COIL:REGION 43->82| COIL:REGION 89->118| TM:NTM 1 TM:REGION 5->27| SEG 8->22|ilatiinfiililil| SEG 97->115|reaeaiinranieiqreee| HM:PFM:NREP 1 HM:PFM:REP 9->137|PF00430|5.9e-27|31.0|129/132|ATP-synt_B| HM:SCP:REP 63->123|1l2pA_|3.3e-06|42.6|61/61|f.23.21.1|1/1|F1F0 ATP synthase subunit B, membrane domain| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-------------------------1-------------------------------------------------------------------------------------------------1--------------1-----1-1--1-111-----------1-----------1-------------------------------------1111111111111--1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 159-160| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //