[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : atpL
DDBJ      :atpL         ATP synthase C chain
Swiss-Prot:ATPL_CLOPE   RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c;         Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->70 2wieA PDBj 5e-06 50.0 %
:RPS:SCOP  35->72 1ijpA  f.17.1.1 * 1e-08 23.7 %
:HMM:SCOP  1->73 1c99A_ f.17.1.1 * 9.7e-16 52.1 %
:RPS:PFM   35->70 PF00137 * ATP-synt_C 7e-04 47.2 %
:HMM:PFM   3->71 PF00137 * ATP-synt_C 7.2e-25 58.5 65/66  
:BLT:SWISS 35->72 ATPL_CLOPE 7e-16 100.0 %
:PROS 34->55|PS00605|ATPASE_C
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81898.1 GT:GENE atpL GT:PRODUCT ATP synthase C chain GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2513238..2513456) GB:FROM 2513238 GB:TO 2513456 GB:DIRECTION - GB:GENE atpL GB:PRODUCT ATP synthase C chain GB:NOTE 72 aa, similar to gp:AE002114_9 ATP synthase C chain from Ureaplasma urealyticum (109 aa); 57.9% identity in 38 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE2192 GB:PROTEIN_ID BAB81898.1 LENGTH 72 SQ:AASEQ MDMKLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIYGLVVSIILLFVA GT:EXON 1|1-72:0| SW:ID ATPL_CLOPE SW:DE RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein; SW:GN Name=atpE; OrderedLocusNames=CPE2192; SW:KW ATP synthesis; Cell membrane; CF(0); Complete proteome;Hydrogen ion transport; Ion transport; Lipid-binding; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 35->72|ATPL_CLOPE|7e-16|100.0|38/72| GO:SWS:NREP 9 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0008289|"GO:lipid binding"|Lipid-binding| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 34->55|PS00605|ATPASE_C|PDOC00526| TM:NTM 2 TM:REGION 7->29| TM:REGION 45->67| SEG 5->34|llaagiavlagigagigigiatagaleata| BL:PDB:NREP 1 BL:PDB:REP 35->70|2wieA|5e-06|50.0|36/81| RP:PFM:NREP 1 RP:PFM:REP 35->70|PF00137|7e-04|47.2|36/70|ATP-synt_C| HM:PFM:NREP 1 HM:PFM:REP 3->71|PF00137|7.2e-25|58.5|65/66|ATP-synt_C| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00137|IPR002379| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00137|IPR002379| GO:PFM GO:0033177|"GO:proton-transporting two-sector ATPase complex, proton-transporting domain"|PF00137|IPR002379| RP:SCP:NREP 1 RP:SCP:REP 35->72|1ijpA|1e-08|23.7|38/79|f.17.1.1| HM:SCP:REP 1->73|1c99A_|9.7e-16|52.1|73/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 36 STR:RPRED 50.0 SQ:SECSTR ##################################HcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH## PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //