[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : cbiB
DDBJ      :cbiB         cobalamin biosynthesis protein
Swiss-Prot:COBD_CLOPE   RecName: Full=Cobalamin biosynthesis protein cobD;

Homologs  Archaea  53/68 : Bacteria  399/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:315 amino acids
:PSIPRED
:RPS:SCOP  85->143 1d5tA1  c.3.1.3 * 3e-04 13.8 %
:RPS:PFM   1->279 PF03186 * CobD_Cbib 2e-70 46.5 %
:HMM:PFM   4->293 PF03186 * CobD_Cbib 1.1e-107 42.1 285/292  
:BLT:SWISS 1->315 COBD_CLOPE 0.0 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80745.1 GT:GENE cbiB GT:PRODUCT cobalamin biosynthesis protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1239636..1240583 GB:FROM 1239636 GB:TO 1240583 GB:DIRECTION + GB:GENE cbiB GB:PRODUCT cobalamin biosynthesis protein GB:NOTE 315 aa, similar to sp:CBIB_SALTY CBIB PROTEIN from Salmonella typhimurium (319 aa); 47.7% identity in 304 aa overlap. 5 putative transmembrane regions were found by PSORT. CPE1039 GB:PROTEIN_ID BAB80745.1 LENGTH 315 SQ:AASEQ MIKIIIGYVLDLIIGDPNNPYHPIRYIGKLASNMEKLWRKVFKKNLKIAGFFAWLFIVFITFGVTLGIVHIANKINPILGTVVSGILIYFCISAKGLKVEGLKVIKILKEGDIVKARKQLSYIVGRDTENLDEEAIVRAVVETVAENMSDGIIAPLFFAGIGGAPLAFLYKAVNTCDSMFGYKNEKYKDFGFFSAKLDDVFNYIPARLTAYLIVISSFILRLNCKNIFKIYKRDRYNHSSPNSAHPEAAVAGALGIRLGGANYYFGKLVEKPTIGDAKKKIEISDVYKTNNILGMVSFLGMVVALIIRCILEVII GT:EXON 1|1-315:0| SW:ID COBD_CLOPE SW:DE RecName: Full=Cobalamin biosynthesis protein cobD; SW:GN Name=cobD; OrderedLocusNames=CPE1039; SW:KW Cell membrane; Cobalamin biosynthesis; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->315|COBD_CLOPE|0.0|100.0|315/315| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009236|"GO:cobalamin biosynthetic process"|Cobalamin biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 5 TM:REGION 1->23| TM:REGION 46->68| TM:REGION 81->103| TM:REGION 207->229| TM:REGION 291->313| RP:PFM:NREP 1 RP:PFM:REP 1->279|PF03186|2e-70|46.5|273/290|CobD_Cbib| HM:PFM:NREP 1 HM:PFM:REP 4->293|PF03186|1.1e-107|42.1|285/292|CobD_Cbib| GO:PFM:NREP 2 GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF03186|IPR004485| GO:PFM GO:0016021|"GO:integral to membrane"|PF03186|IPR004485| RP:SCP:NREP 1 RP:SCP:REP 85->143|1d5tA1|3e-04|13.8|58/336|c.3.1.3| OP:NHOMO 464 OP:NHOMOORG 452 OP:PATTERN 11----1111111111-11-1111----11--1111111111111111111111111111-111--11 ---11-11----1-11111-11--1111111111111111-1-1----------------11111111111----------1------11-1-111---------1-1-----------------11111111111111113241-1111111111111111--1111111111111111111111------1-----------------1-------1111---11111111---------------------------------11---------------------------------------------1----------1111111111111111111111111--1111111111--111211--1111-1--------11111---1111111111111111-21111111-1--1111111111111111-111111111111111111-11-1111-------------------------------1--------1111111111111111111111111111--111-111111111-11112111-----------111-1111-11111111-111111111-----1-1-----------------------------1-1-1-11---111--1111--11--2-----11-------1---1--------------------------------111--11-1111111111111111----------1------------------------111-1-------------------------1111111111111111111------------1--------2----11111---------11--1111--------1---------------------------1--11-1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccEEEccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //