[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : cbiT
DDBJ      :cbiT         precorrin-8w decarboxylase
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  110/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->194 3e05H PDBj 2e-26 34.6 %
:RPS:PDB   4->194 3e05C PDBj 1e-13 35.2 %
:RPS:SCOP  4->190 1f38A  c.66.1.22 * 3e-31 29.0 %
:HMM:SCOP  17->195 1nw3A_ c.66.1.31 * 5.9e-30 30.5 %
:RPS:PFM   29->91 PF01135 * PCMT 2e-06 36.5 %
:HMM:PFM   26->97 PF05175 * MTS 1.4e-11 25.0 72/170  
:BLT:SWISS 4->190 CBIT_SULTO 9e-29 41.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80930.1 GT:GENE cbiT GT:PRODUCT precorrin-8w decarboxylase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1427172..1427765) GB:FROM 1427172 GB:TO 1427765 GB:DIRECTION - GB:GENE cbiT GB:PRODUCT precorrin-8w decarboxylase GB:NOTE 197 aa, similar to sp:CBIT_SALTY PRECORRIN-8W DECARBOXYLASE (EC 1.-.-.-) from Salmonella typhimurium (192 aa); 29.9% identity in 194 aa overlap CPE1224 GB:PROTEIN_ID BAB80930.1 LENGTH 197 SQ:AASEQ MKFIKDSEFIRGKCPMTKEDIRILTISKLDLDKDSNFLDIGSGTGSITIQASKFIEVGSVFSIERDEEAIRVTKENLKKFNCNNVTLLEGDAIEHIESLSKEIKEEKISKFDSIFIGGSGGGLEKIINISDEILKEDGVLVLNFITLNNAYNAIEFLKKLEYKTEISLVNISKNRENTYMMISNNPIFIVKAFKEEN GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 4->190|CBIT_SULTO|9e-29|41.0|178/192| SEG 93->127|iehieslskeikeekiskfdsifiggsggglekii| BL:PDB:NREP 1 BL:PDB:REP 4->194|3e05H|2e-26|34.6|182/191| RP:PDB:NREP 1 RP:PDB:REP 4->194|3e05C|1e-13|35.2|182/190| RP:PFM:NREP 1 RP:PFM:REP 29->91|PF01135|2e-06|36.5|63/205|PCMT| HM:PFM:NREP 1 HM:PFM:REP 26->97|PF05175|1.4e-11|25.0|72/170|MTS| GO:PFM:NREP 2 GO:PFM GO:0004719|"GO:protein-L-isoaspartate (D-aspartate) O-methyltransferase activity"|PF01135|IPR000682| GO:PFM GO:0006464|"GO:protein modification process"|PF01135|IPR000682| RP:SCP:NREP 1 RP:SCP:REP 4->190|1f38A|3e-31|29.0|176/186|c.66.1.22| HM:SCP:REP 17->195|1nw3A_|5.9e-30|30.5|167/328|c.66.1.31|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 135 OP:NHOMOORG 134 OP:PATTERN -------111111111--1-1--------------1-111111------1-11----------1--11 ---------------------------------------------------------------------------------1----------------------------------------------------------1-----211111---11------11111111---------------------1-------------------------111----111-11-----------------------------------11---------------------------------------------1----------111111111111111111111111----111-11111--1111----11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1------------111111111-----1-------------------------------1----------------------------------------1---1--------------------------------111--11-1111111111111111----------1---------------------------------------------------------------------------------------------------------------------11----------1------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 99.5 SQ:SECSTR cccccGGGccccTTTcccHHHHHHHHHHTTccTTcEEEEETcTTcHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHHHHTcTTEEEEEccTTTTGGGcccccEEEEcccTTcHHHHHHHHcHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHHHTTcEEEEEEEccEEccccccccEEcccEEEEEEEccc# DISOP:02AL 196-197| PSIPRED ccccccHHHHccccccccHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHccccccccccccccEEEEccccccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEEEEEcccccEEHHHcccEEEEEEEEccc //