[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : cdsA
DDBJ      :cdsA         phosphatidate cytidylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  693/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
:264 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->260 PF01148 * CTP_transf_1 4e-30 38.1 %
:HMM:PFM   7->260 PF01148 * CTP_transf_1 5.7e-58 31.7 246/259  
:BLT:SWISS 79->249 CDSA_STAHJ 3e-31 40.4 %
:PROS 219->245|PS01315|CDS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81401.1 GT:GENE cdsA GT:PRODUCT phosphatidate cytidylyltransferase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1974432..1975226) GB:FROM 1974432 GB:TO 1975226 GB:DIRECTION - GB:GENE cdsA GB:PRODUCT phosphatidate cytidylyltransferase GB:NOTE 264 aa, similar to gpu:AP001515_156 phosphatidate cytidylyltransferase (EC 2.7.7.41) from Bacillus halodurans (264 aa); 34.7% identity in 239 aa overlap. Putative N-terminal signal sequence and 6 putative transmembrane regions were found by PSORT. CPE1695 GB:PROTEIN_ID BAB81401.1 LENGTH 264 SQ:AASEQ MKSNSRYLGALIMAPFIAFIFLGGIWLKLFTIALSFAGLYEYYKTVKIAKLKPISIGGYILLILYYLTSNNFEMLSFLIIIATFILLCVPILNIEYTFIDVAVTILGFIYVGVFFSFIHLVNIKEGGQYLVWLIFLSSWLCDTAAYYSGRFFGKHKLCPKVSPKKTIEGSIGGILGSTLACGIFGIIISNSFSLIPVYHYFIIGILCGVFCQFGDLVASSIKRYAGIKDYSNLIPGHGGILDRFDSILFAGTIVFFYLTLVLKF GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 79->249|CDSA_STAHJ|3e-31|40.4|166/260| PROS 219->245|PS01315|CDS|PDOC01019| TM:NTM 7 TM:REGION 12->34| TM:REGION 52->73| TM:REGION 76->98| TM:REGION 100->122| TM:REGION 131->152| TM:REGION 197->219| TM:REGION 238->260| SEG 56->67|iggyillilyyl| SEG 182->195|gifgiiisnsfsli| RP:PFM:NREP 1 RP:PFM:REP 11->260|PF01148|4e-30|38.1|247/262|CTP_transf_1| HM:PFM:NREP 1 HM:PFM:REP 7->260|PF01148|5.7e-58|31.7|246/259|CTP_transf_1| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF01148|IPR000374| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01148|IPR000374| OP:NHOMO 834 OP:NHOMOORG 726 OP:PATTERN -------------------------------------------------------------------- 111-111111111-11111-111111111111-111-1--1111---11---1111--1111111111--11---11111111-1111111111111--12111111111--11-1-11-----1111111111111111-111--11-21111111-11-111-11111111111111111111---111-111111111111111111111111111-111111111111-11111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111-----1-1-11------11-------------1-------1----12----1-111-11--1-2-2111111-11111111-11--1--111111111111111111111111111111---11-----111111-----1111-----12211111-1-----1--1-1-1---11111-11111111-----1211111111-11111---2---111--1111-1-111111111-111-11---11111111---1111111----11-------11-111-12---------11111112222222222-2222211222222222222-----222111111111111111111112221111222222222221111-----11111-11-1111211111111121-11111--1--2222-2121-----2111111111111-11122222--111221111111111111-111111111-111-11--1---11-1111------111---1111111111111111 ---------1-------1--------------------------------------1------1-----1--------------1------------------111--2--------------------12----------------------------------------22---111A111112----312254581 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHc //