[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : clg
DDBJ      :clg          collagen-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.22.1
:397 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   245->357 1c28B PDBj 7e-08 29.5 %
:RPS:SCOP  277->363 1rj7A  b.22.1.1 * 7e-08 6.9 %
:HMM:PFM   56->108 PF01391 * Collagen 2.1e-11 45.3 53/60  
:HMM:PFM   96->151 PF01391 * Collagen 2.8e-10 48.2 56/60  
:HMM:PFM   138->192 PF01391 * Collagen 1.6e-09 45.5 55/60  
:HMM:PFM   180->235 PF01391 * Collagen 9.7e-12 42.9 56/60  
:HMM:PFM   278->356 PF00386 * C1q 8.8e-06 29.7 74/127  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80661.1 GT:GENE clg GT:PRODUCT collagen-like protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1153011..1154204) GB:FROM 1153011 GB:TO 1154204 GB:DIRECTION - GB:GENE clg GB:PRODUCT collagen-like protein GB:NOTE 397 aa, similar to gp:AB004104_3 ORF10291-3 from Clostridium perfringens (113 aa); 47.5% identity in 40 aa overlap CPE0955 GB:PROTEIN_ID BAB80661.1 LENGTH 397 SQ:AASEQ MIRKIYNPNRYYDDYNRYNCYDDEYCQDDYYCKEDCYCKDDCYLEINCNCCDCCKPGPRGPRGPQGPRGPQGPRGPMGCQGERGPIGPMGPMGPIGPKGPQGEQGLTGPQGPAGPQGEQGPQGEQGPVGPIGPQGPQGEQGLTGPQGPAGSQGPEGPTGPQGATGPQGPEGPTGAQGDQGPVGPQGAQGPQGPQGPQGATGPTGPQGPQGNQGPAGPQGPVGPQGPQGPQGEPGVDFDDTLSVSYSSLTSQNVNANGIFTYNIQNPNGSTFTAITANIANGTFTINEPGRYLFMWSFNLDNTNNTTASAIVSLFRNGSRVFLSGTPRVAPGEIGVVNGSIAVNANAGDVFTLVNNSTRNVLSQIISSPISVTPAILGESTGINSGIGSWVQIVRVSD GT:EXON 1|1-397:0| SEG 6->43|ynpnryyddynryncyddeycqddyyckedcyckddcy| SEG 56->76|pgprgprgpqgprgpqgprgp| SEG 84->100|gpigpmgpmgpigpkgp| SEG 104->148|qgltgpqgpagpqgeqgpqgeqgpvgpigpqgpqgeqgltgpqgp| SEG 152->234|qgpegptgpqgatgpqgpegptgaqgdqgpvgpqgaqgpqgpqgpqgatgptgpqgpqgnqgpagpqgpvgpqgpqgpqgepg| RP:PDB:NREP 1 RP:PDB:REP 245->357|1c28B|7e-08|29.5|95/111| HM:PFM:NREP 5 HM:PFM:REP 56->108|PF01391|2.1e-11|45.3|53/60|Collagen| HM:PFM:REP 96->151|PF01391|2.8e-10|48.2|56/60|Collagen| HM:PFM:REP 138->192|PF01391|1.6e-09|45.5|55/60|Collagen| HM:PFM:REP 180->235|PF01391|9.7e-12|42.9|56/60|Collagen| HM:PFM:REP 278->356|PF00386|8.8e-06|29.7|74/127|C1q| RP:SCP:NREP 1 RP:SCP:REP 277->363|1rj7A|7e-08|6.9|87/144|b.22.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 29.5 SQ:SECSTR ####################################################################################################################################################################################################################################################EEEcccccccccEEE#EcTTccccEEEEcTcEETTTTEEEccccEEEEEEEEEEEEEccEEcccccEEEEEccccccEEEccccccccEEEEEEEEEEEEcTTcEEEEEcccEccTTc################################### DISOP:02AL 55-268| PSIPRED cccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEEEccccccccEEEEEEEEEccccccccccccccccccccccEEEEEEEccccEEEEEcccHHHHHHHHHHcccEEcHHHHccccccccccccEEEEEEEcc //