[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : def.2
DDBJ      :def          polypeptide deformylase
Swiss-Prot:DEF2_CLOPE   RecName: Full=Peptide deformylase 2;         Short=PDF 2;         EC=3.5.1.88;AltName: Full=Polypeptide deformylase 2;

Homologs  Archaea  1/68 : Bacteria  830/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->148 1y6hA PDBj 3e-29 43.5 %
:RPS:PDB   1->155 3cpmA PDBj 4e-45 33.5 %
:RPS:SCOP  2->145 1bs4A  d.167.1.1 * 2e-40 41.3 %
:HMM:SCOP  2->156 1v3yA_ d.167.1.1 * 5e-49 40.9 %
:RPS:PFM   6->149 PF01327 * Pep_deformylase 6e-31 45.8 %
:HMM:PFM   3->149 PF01327 * Pep_deformylase 1.9e-50 47.6 147/157  
:BLT:SWISS 1->155 DEF2_CLOPE 3e-86 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81339.1 GT:GENE def.2 GT:PRODUCT polypeptide deformylase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1905910..1906377) GB:FROM 1905910 GB:TO 1906377 GB:DIRECTION - GB:GENE def GB:PRODUCT polypeptide deformylase GB:NOTE 155 aa, similar to sp:DEF_CLOAB POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) from Clostridium acetobutylicum (150 aa); 45.9% identity in 148 aa overlap CPE1633 formylmethionine deformylase GB:PROTEIN_ID BAB81339.1 LENGTH 155 SQ:AASEQ MAVKKIVQIGHEALKKVSEPVKDVNEVKGLIQDLKDTLATVEGIGLAAPQIAVNKRVVYINFGDGENEYVLINPEVTGVSKETYEDYEGCLSYVMHEGLVERPRAVRIQALNEKGELKVYEAQDLLARCFLHEIDHLEGIMYVDRAKEMYELVEK GT:EXON 1|1-155:0| SW:ID DEF2_CLOPE SW:DE RecName: Full=Peptide deformylase 2; Short=PDF 2; EC=3.5.1.88;AltName: Full=Polypeptide deformylase 2; SW:GN Name=def2; OrderedLocusNames=CPE1633; SW:KW Complete proteome; Hydrolase; Iron; Metal-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|DEF2_CLOPE|3e-86|100.0|155/155| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->148|1y6hA|3e-29|43.5|147/177| RP:PDB:NREP 1 RP:PDB:REP 1->155|3cpmA|4e-45|33.5|155/184| RP:PFM:NREP 1 RP:PFM:REP 6->149|PF01327|6e-31|45.8|144/155|Pep_deformylase| HM:PFM:NREP 1 HM:PFM:REP 3->149|PF01327|1.9e-50|47.6|147/157|Pep_deformylase| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01327|IPR000181| GO:PFM GO:0006412|"GO:translation"|PF01327|IPR000181| GO:PFM GO:0042586|"GO:peptide deformylase activity"|PF01327|IPR000181| RP:SCP:NREP 1 RP:SCP:REP 2->145|1bs4A|2e-40|41.3|143/168|d.167.1.1| HM:SCP:REP 2->156|1v3yA_|5e-49|40.9|154/0|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 1339 OP:NHOMOORG 883 OP:PATTERN ---------------------------------------------2---------------------- 12113222222222--1----111-1------1111221112212121222233322311332-2233422122211111111122211111-1111--11111-21-111111111111111121111111111111111111212222222221111112111122222121111121111111--1111222222222222222221122222222222122111111312222222222222222222211--11--112---------------11111111-------------1111111111111-11111111111322444443324122442222111111111111121111111111111-11111111111212111111111122222221222-221221221121222222222222121111322322223222222222222212222122222111121331332312211111111111222222222222222222222222222222222122222222222222233222221211111112222221111111111111112222222221111331111111-----111111111111111222111112121212222222333323223221-1112111111111111111111111121-111111111111111111111211212111111111111111111111111111111111111111111-----2333211111111111111111112222212111112222222212222122222212222211112222221212211222222221111112111111111-11111111----------111-----11-11111111111111112 11------2-----1--------------------------------------------------------------------------------------------12---1111-------11--1-121--1--------21-------11---11------112-18--1113229222114213-31-221113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR ccccccccTTcGGGTccccccccccHHHHHHHHHHHHHHHTTccEEEGGGGTccccEEEEcccccTTcEEEEEEEEEEEcccEEEEEEccTTcTTccEEEEEEccEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHHTTccGGGGTHHHHHHHHH DISOP:02AL 150-155| PSIPRED ccHHHHHHcccHHHccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEEEcccccccEEEEccEEEEccccEEEcccccEEccccEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEEEHHccccEEEEEEcccccccccc //