[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : dnaC.2
DDBJ      :dnaC         replicative DNA helicase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  6/199 : Viruses  19/175   --->[See Alignment]
a.81.1c.37.1
:444 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   10->436 2r6aA PDBj e-128 52.2 %
:RPS:PDB   10->111 1b79B PDBj 1e-28 37.3 %
:RPS:PDB   128->443 3cmxA PDBj 5e-34 11.3 %
:RPS:SCOP  10->110 1b79A  a.81.1.1 * 1e-28 37.6 %
:RPS:SCOP  170->413 1cr0A  c.37.1.11 * 2e-33 20.1 %
:HMM:SCOP  6->119 1jweA_ a.81.1.1 * 2.2e-34 39.5 %
:HMM:SCOP  104->236 1w36D1 c.37.1.19 * 0.00096 20.2 %
:HMM:SCOP  181->430 1n0wA_ c.37.1.11 * 4.9e-59 40.5 %
:RPS:PFM   8->110 PF00772 * DnaB 2e-22 41.7 %
:RPS:PFM   185->364 PF03796 * DnaB_C 1e-63 62.8 %
:HMM:PFM   184->365 PF03796 * DnaB_C 1.9e-76 59.9 182/185  
:HMM:PFM   9->110 PF00772 * DnaB 3.2e-34 44.1 102/103  
:BLT:SWISS 10->438 DNAC_BACSU e-127 51.3 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82340.1 GT:GENE dnaC.2 GT:PRODUCT replicative DNA helicase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(3007583..3008917) GB:FROM 3007583 GB:TO 3008917 GB:DIRECTION - GB:GENE dnaC GB:PRODUCT replicative DNA helicase GB:NOTE 444 aa, similar to prf:2513242A helicase from Bacillus stearothermophilus (454 aa); 52.2% identity in 429 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE2634 GB:PROTEIN_ID BAB82340.1 LENGTH 444 SQ:AASEQ MEAPVMKSLPQSIEAEQSVLGAMIIDRTTIAQAAEVLNKDSFYRDAHKVIFQSIIEMYQRDQAVDQLTLLEYLKSTDRLEKAGGISYVTEISASVLSTVNIKSYIKIVDEKAMLRRLIKSSTEIIENCYNNQEDVEKVIDSAEKKIFDLSEKRSSNDFEPLSVVLERGFEQIEAIFNNEGELTGVGSGFKDLDEMTSGFQKGDMVLIAARPSMGKTTFALNIAEHAALREGKSVVIFSLEMSKEQLAYKLLCSEANVDMLSLRTGKLTPEDWDNIARASGPLASAKIYIDDTAGVSVMEMRSKCRRLKMEYGIDLILIDYLQLMSGSGESRQQEVAEISRNIKAIAKEMECPVIALSQLSRAPEQRADHRPMLSDLRESGSIEQDADLVMFLYRDEYYNKETEDKNVGECIIAKQRNGPVGTVKLAWLGQYSKFADYEAIHKDV GT:EXON 1|1-444:0| BL:SWS:NREP 1 BL:SWS:REP 10->438|DNAC_BACSU|e-127|51.3|429/454| COIL:NAA 23 COIL:NSEG 1 COIL:REGION 130->152| BL:PDB:NREP 1 BL:PDB:REP 10->436|2r6aA|e-128|52.2|416/420| RP:PDB:NREP 2 RP:PDB:REP 10->111|1b79B|1e-28|37.3|102/103| RP:PDB:REP 128->443|3cmxA|5e-34|11.3|284/1603| RP:PFM:NREP 2 RP:PFM:REP 8->110|PF00772|2e-22|41.7|103/103|DnaB| RP:PFM:REP 185->364|PF03796|1e-63|62.8|180/184|DnaB_C| HM:PFM:NREP 2 HM:PFM:REP 184->365|PF03796|1.9e-76|59.9|182/185|DnaB_C| HM:PFM:REP 9->110|PF00772|3.2e-34|44.1|102/103|DnaB| GO:PFM:NREP 6 GO:PFM GO:0003678|"GO:DNA helicase activity"|PF00772|IPR007693| GO:PFM GO:0005524|"GO:ATP binding"|PF00772|IPR007693| GO:PFM GO:0006260|"GO:DNA replication"|PF00772|IPR007693| GO:PFM GO:0003678|"GO:DNA helicase activity"|PF03796|IPR007694| GO:PFM GO:0005524|"GO:ATP binding"|PF03796|IPR007694| GO:PFM GO:0006260|"GO:DNA replication"|PF03796|IPR007694| RP:SCP:NREP 2 RP:SCP:REP 10->110|1b79A|1e-28|37.6|101/102|a.81.1.1| RP:SCP:REP 170->413|1cr0A|2e-33|20.1|219/241|c.37.1.11| HM:SCP:REP 6->119|1jweA_|2.2e-34|39.5|114/114|a.81.1.1|1/1|N-terminal domain of DnaB helicase| HM:SCP:REP 104->236|1w36D1|0.00096|20.2|129/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 181->430|1n0wA_|4.9e-59|40.5|220/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1187 OP:NHOMOORG 934 OP:PATTERN -------------------------------------------------------------------- 1111211111211111111-12111111111112121111111111113111111111111111111111111111111111111111112122111-11111111111121221111221111111111111111111111111112111111111111111111132311111111111211111111111222222132123425311111122311211111111113211111122211111111111112111111111111111121111112111111111111111111111222111111111121111111121111111112122112431121111111211111212111111112111111111115113111111111111111111111112-112214212112111111111111211111111111111111111111112111111111111112Q11111111111111111111111111111111112111111111111111411111112211412131111111121111232211111112111221111115111122112111111111111111-111111111111111111111111111111111111111111111111111111111111111111112113211211121232121131211122211111121112113323122112212212213111223211211111111311111111111111111111111121221--132131132121111112221211121131112111111111111141111111111111121112211111111111111322111111115D611112122111111111111111112111111112 -------------2-----------------------------------------------------------------------------------------------------------------------------------------------------1---------1-1------------3-----1---- ---------1----1--------------1-----------------------1-----11---------------------------------1--1-------1-----1-------------------------1---1-11--1-----2-11--------1--------- DISOP:02AL 1-3, 127-134, 178-180, 325-334, 363-373, 439-444| PSIPRED ccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHcHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHccccEEEEEccEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccEEEEEEEEEcccccHHHcccccccc //