[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : dnaJ
DDBJ      :dnaJ         heat shock protein
Swiss-Prot:DNAJ_CLOPE   RecName: Full=Chaperone protein dnaJ;

Homologs  Archaea  26/68 : Bacteria  910/915 : Eukaryota  197/199 : Viruses  2/175   --->[See Alignment]
a.2.3b.4.1d.227.1g.54.1
:387 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->68 1hdjA PDBj 3e-19 59.4 %
:BLT:PDB   124->348 1nltA PDBj 1e-24 30.3 %
:RPS:PDB   2->68 1bq0A PDBj 1e-20 62.7 %
:RPS:PDB   143->387 1cmwA PDBj 1e-53 11.4 %
:RPS:SCOP  2->68 1bq0A  a.2.3.1 * 6e-21 62.7 %
:RPS:SCOP  144->226 1exkA  g.54.1.1 * 6e-19 49.4 %
:RPS:SCOP  227->364 2d7vA1  d.227.1.1 * 7e-27 8.4 %
:HMM:SCOP  1->109 1gh6A_ a.2.3.1 * 6.3e-31 52.4 %
:HMM:SCOP  128->271 1c3gA1 b.4.1.1 * 2e-21 40.0 %
:HMM:SCOP  272->359 1c3gA2 b.4.1.1 * 3.1e-25 44.3 %
:RPS:PFM   5->66 PF00226 * DnaJ 2e-20 71.0 %
:RPS:PFM   144->221 PF00684 * DnaJ_CXXCXGXG 2e-24 65.4 %
:RPS:PFM   259->350 PF01556 * DnaJ_C 3e-24 56.5 %
:HMM:PFM   225->267 PF01556 * DnaJ_C 1.6e-07 39.5 43/101  
:HMM:PFM   259->356 PF01556 * DnaJ_C 1.8e-35 46.9 98/101  
:HMM:PFM   5->67 PF00226 * DnaJ 4.7e-31 68.3 63/64  
:HMM:PFM   144->221 PF00684 * DnaJ_CXXCXGXG 4.5e-23 50.0 78/79  
:BLT:SWISS 1->387 DNAJ_CLOPE 0.0 100.0 %
:PROS 47->66|PS00636|DNAJ_1
:REPEAT 2|150->188|193->228
:REPEAT 2|232->276|309->353
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81738.1 GT:GENE dnaJ GT:PRODUCT heat shock protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2322479..2323642) GB:FROM 2322479 GB:TO 2323642 GB:DIRECTION - GB:GENE dnaJ GB:PRODUCT heat shock protein GB:NOTE 387 aa, similar to sp:DNAJ_CLOAB DNAJ PROTEIN from Clostridium acetobutylicum (374 aa); 61.4% identity in 368 aa overlap CPE2032 GB:PROTEIN_ID BAB81738.1 LENGTH 387 SQ:AASEQ MAKRDYYEVLGLQKGASDDEIKRAFRKMAMKYHPDRNPGDKEAEENFKEVNEAYDVLKDPDKKAKYDQFGHAAFDGSGGFGGGGFGGFDAGGFDFSEMGGFGDIFESFFGGGFGGGSSRRRNAPQRGADLEYRLNITFEEAVFGCEKEISITRTENCETCHGTGAKAGTSPKTCPKCNGSGQIRVQRQTPLGSFVSTTTCDQCGGTGKVIEDPCPDCKGKGTVRKNRKITVKIPAGVDTGNIIPLRGQGEQGANNGPAGDLYIRVNVAPSKIFRREGSDIYYDYKISMAKAALGAEITVPTVDGNVKYKVPAGTQPGTKFRLKGKGVPHVNGGGRGNQYVHMVVEVPKHLNKEQEEALKAFMKASGESVDDIDEKDEGFFSKFKKKK GT:EXON 1|1-387:0| SW:ID DNAJ_CLOPE SW:DE RecName: Full=Chaperone protein dnaJ; SW:GN Name=dnaJ; OrderedLocusNames=CPE2032; SW:KW Chaperone; Complete proteome; Cytoplasm; DNA replication;Metal-binding; Repeat; Stress response; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->387|DNAJ_CLOPE|0.0|100.0|387/387| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 47->66|PS00636|DNAJ_1|PDOC00553| NREPEAT 2 REPEAT 2|150->188|193->228| REPEAT 2|232->276|309->353| SEG 69->95|fghaafdgsggfggggfggfdaggfdf| SEG 99->118|ggfgdifesffgggfgggss| BL:PDB:NREP 2 BL:PDB:REP 4->68|1hdjA|3e-19|59.4|64/77| BL:PDB:REP 124->348|1nltA|1e-24|30.3|221/228| RP:PDB:NREP 2 RP:PDB:REP 2->68|1bq0A|1e-20|62.7|67/77| RP:PDB:REP 143->387|1cmwA|1e-53|11.4|228/817| RP:PFM:NREP 3 RP:PFM:REP 5->66|PF00226|2e-20|71.0|62/63|DnaJ| RP:PFM:REP 144->221|PF00684|2e-24|65.4|78/78|DnaJ_CXXCXGXG| RP:PFM:REP 259->350|PF01556|3e-24|56.5|92/95|DnaJ_C| HM:PFM:NREP 4 HM:PFM:REP 225->267|PF01556|1.6e-07|39.5|43/101|DnaJ_C| HM:PFM:REP 259->356|PF01556|1.8e-35|46.9|98/101|DnaJ_C| HM:PFM:REP 5->67|PF00226|4.7e-31|68.3|63/64|DnaJ| HM:PFM:REP 144->221|PF00684|4.5e-23|50.0|78/79|DnaJ_CXXCXGXG| GO:PFM:NREP 6 GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00226|IPR001623| GO:PFM GO:0006457|"GO:protein folding"|PF00684|IPR001305| GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00684|IPR001305| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF00684|IPR001305| GO:PFM GO:0006457|"GO:protein folding"|PF01556|IPR002939| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF01556|IPR002939| RP:SCP:NREP 3 RP:SCP:REP 2->68|1bq0A|6e-21|62.7|67/77|a.2.3.1| RP:SCP:REP 144->226|1exkA|6e-19|49.4|79/79|g.54.1.1| RP:SCP:REP 227->364|2d7vA1|7e-27|8.4|131/155|d.227.1.1| HM:SCP:REP 1->109|1gh6A_|6.3e-31|52.4|105/0|a.2.3.1|1/1|Chaperone J-domain| HM:SCP:REP 128->271|1c3gA1|2e-21|40.0|80/80|b.4.1.1|1/2|HSP40/DnaJ peptide-binding domain| HM:SCP:REP 272->359|1c3gA2|3.1e-25|44.3|88/90|b.4.1.1|2/2|HSP40/DnaJ peptide-binding domain| OP:NHOMO 5544 OP:NHOMOORG 1135 OP:PATTERN ------------------------11111111111--------2212211211--------111--22 2222322222222222222-22222222222222222253233322222222222232222222222322222222223232222222222212111112321323323211111111111111111111111121333332222243543356534333333433355552323222323322212211211111111111111111111111111111121221111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121123222222222121222212211221241222212212111112113222222422222233232222222222222222222124224232233142223333333322222112111111122222222222222331111111111111111111111111111112233222222211112111111133111111113232222221311222223213343111112222222222325233232322322232222323222222223552212222222222222222222222221111212122311111122111111111111-1321211111121111112222222222-22222222222222222222221111222222222222222222222222211211111111111111122222322222222111121111-11111222221222221111122221222213332222222222222111111111112222222222222211221111112221221221111112-11111421111112111111111121222221 FC79IGG-sKN4JLKAFEFBFFDDBCEA9ABCCBEBEGDFAGECDDEDECCBDEB9CABCCDACCCCA5ACAC9CBB6BA9CAC9CCD-BGDFDCBA88CACCNKJ1EoBdenbXbNJGEIJPGjbFdG**X1aVeHICHd9NcPEIHIERFDgHMMQMGILLJGEEeIMaFHRDAQMN*EFDJIeeitFoVGLQNTMW --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1- STR:NPRED 387 STR:RPRED 100.0 SQ:SECSTR cccccHHHHHTccTTccHHHHHHHHHHHHHHTcTTTccccTTHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHGGHHHHHHHHHcTTcccEEEEEcTTTTcEEEEEETTccEEEccccccccTcccccccccccccccccccccccccccccccHHHHTTTTTTTTTTTccHHHHHHHHHHHHEEETHHHHHHTccTTTcccTTTcccccEEEcccccccccEEEcccGGGccTTcHHHHHHHHTccccTTEEEEEEEETTHHHHHHHHHHTcHHHHHHHHHTccHHHHHHHTccHHHHHHHHHHTccGGGccHTTcHHHHHHHHHHHHTTccccHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHTcccccccccc DISOP:02AL 1-2, 72-87, 111-131, 159-184, 360-380| PSIPRED ccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccEEEEEEcHHHHccccEEEEEEcccEEcccccccccccccEEEEccccccccEEEEEEEcccEEEEEEEEcHHHcccccEEEEccccccccEEEEccEEEEEEEccccccccEEEEEccccccccccccccEEEEEEEEccccEEEcccEEEEEEEccHHHHHcccEEEEEccccEEEEEcccccccccEEEEcccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccccccccccccHHHHHHccc //