[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : etfB.1
DDBJ      :etfB         electron transfer flavoprotein beta-subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  508/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->223 1efpB PDBj 3e-14 25.2 %
:RPS:PDB   1->262 2a1uB PDBj 1e-52 28.2 %
:RPS:SCOP  1->232 1efpB  c.26.2.3 * 7e-50 24.1 %
:HMM:SCOP  1->259 1o97C_ c.26.2.3 * 5.4e-83 43.1 %
:RPS:PFM   34->178 PF01012 * ETF 6e-17 37.4 %
:HMM:PFM   24->185 PF01012 * ETF 1.5e-43 37.8 156/164  
:BLT:SWISS 1->256 ETFB_CLOTS 2e-56 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80017.1 GT:GENE etfB.1 GT:PRODUCT electron transfer flavoprotein beta-subunit GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 395519..396307 GB:FROM 395519 GB:TO 396307 GB:DIRECTION + GB:GENE etfB GB:PRODUCT electron transfer flavoprotein beta-subunit GB:NOTE 262 aa, similar to sp:ETFB_CLOTS ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT (BETA-ETF) (ELECTRON TRANSFER FLAVOPROTEIN SMALL SUBUNIT) (ETFSS) from Clostridium thermosaccharolyticum (260 aa); 44.9% identity in 256 aa overlap CPE0311 GB:PROTEIN_ID BAB80017.1 LENGTH 262 SQ:AASEQ MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPHVANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYGLNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 1->256|ETFB_CLOTS|2e-56|45.5|253/260| BL:PDB:NREP 1 BL:PDB:REP 1->223|1efpB|3e-14|25.2|214/246| RP:PDB:NREP 1 RP:PDB:REP 1->262|2a1uB|1e-52|28.2|248/252| RP:PFM:NREP 1 RP:PFM:REP 34->178|PF01012|6e-17|37.4|139/157|ETF| HM:PFM:NREP 1 HM:PFM:REP 24->185|PF01012|1.5e-43|37.8|156/164|ETF| RP:SCP:NREP 1 RP:SCP:REP 1->232|1efpB|7e-50|24.1|224/246|c.26.2.3| HM:SCP:REP 1->259|1o97C_|5.4e-83|43.1|255/0|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 997 OP:NHOMOORG 683 OP:PATTERN 22----2222222222-22312212112-111-----------------------------2322--- 1231211111111111111-1111111111111111112211111--11----11-12--112-1111121---------21------11111122---111111111-1---------------1111111111111122---11-------11-----------1-----------------1-11--11211111111111111111111111111131111------21----------------------1-------------------------------------------------------------------1532444444443431422422214-1-1-12-973463-141--11-2-12-1---11111222221112222211111111111-1121131112113112334335232211111111111111111111112211322-----------------------------1121112---21112211111111251111112441112111214-22221--1-111-11111----------1-115422----------7371825--11211114-------------------------1111-1111121-1111111311112132111-----1-------1-1-1--2222222221-2222222222222222221-------13221333332313113--112221-----------------1111111111-1-11---------------11111111114111111111111111112-------------------11---11--1--1111111--11111111----------1-------------------------11111121111-- ----111-111---1-111111111111111111111111-11-1111111111-1111111111111-11111111111111111-1-1211-111-11111112-1-12111--1----11-11-3-252--12-11-1111-----11--1---111111-111---211111-1-----1-1112-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 100.0 SQ:SECSTR cEEEEEccEEEcTccccccTTccccccTTccEEEcHHHHHHHHHHHHHHHTTccEEEEEEEEcTTHHHHHHHHHHHTccEEEEEEccHHHHccHHHHHHHHHHHHHHHTTccEEEEEcccTTTccccHHHHHHHHHTccEEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcTTccccccccHHHHHHHTTccEEEEcGGGGTcccGGGccGGccccccccccccccccccccccccHHHHHHHHHHHHHHTTcc DISOP:02AL 228-243| PSIPRED cEEEEEEEEcccccccEEEEcccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHcccEEEEEEEEEEEEccEEEEEEEccccEEEEEEcccEEEEEEccccccccccHHHHHHHcccccEEEcHHHHccccHHHHccccccEEEEEEEccccccccEEEcccHHHHHHHHHHHHHHcccc //