[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : eutL
DDBJ      :eutL         ethanolamine utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->214 3gfhA PDBj 6e-55 49.3 %
:RPS:PDB   9->126 3cgiC PDBj 1e-18 20.2 %
:HMM:PFM   34->108 PF00936 * BMC 8.7e-16 31.2 64/75  
:HMM:PFM   146->211 PF00936 * BMC 2.4e-12 34.4 64/75  
:BLT:SWISS 4->215 EUTL_ECOLI 1e-54 49.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80606.1 GT:GENE eutL GT:PRODUCT ethanolamine utilization protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1102436..1103089 GB:FROM 1102436 GB:TO 1103089 GB:DIRECTION + GB:GENE eutL GB:PRODUCT ethanolamine utilization protein GB:NOTE 217 aa, similar to sp:EUTL_ECOLI ETHANOLAMINE UTILIZATION PROTEIN EUTL from Escherichia coli (219 aa); 49.1% identity in 212 aa overlap CPE0900 GB:PROTEIN_ID BAB80606.1 LENGTH 217 SQ:AASEQ MKNDLIRPNVLSVKIISNVSPEMAKKLELEPHHKSLGLITADCDDVTYTALDEATKAAEVDVVYARSMYAGAGNASTKLAGEVIGILAGPSPAEVRSGLNATLDFIDSGVGFVSANEDDSICYYAQCVSRTGSYLSKTAGIREGEALAYLVAPPLEAMYALDAALKAADVEMCEFFAPPTETNFAGALLTGSQSACKAACDAFAEAVQSVASNPLGF GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 4->215|EUTL_ECOLI|1e-54|49.1|212/219| SEG 160->169|aldaalkaad| SEG 195->206|ackaacdafaea| BL:PDB:NREP 1 BL:PDB:REP 4->214|3gfhA|6e-55|49.3|211/214| RP:PDB:NREP 1 RP:PDB:REP 9->126|3cgiC|1e-18|20.2|104/119| HM:PFM:NREP 2 HM:PFM:REP 34->108|PF00936|8.7e-16|31.2|64/75|BMC| HM:PFM:REP 146->211|PF00936|2.4e-12|34.4|64/75|BMC| OP:NHOMO 80 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111---------------------1-----------------------------------------------------------1----------11-------------1---11-11--------11-1-----------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------1------1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 97.2 SQ:SECSTR ###cEEccEEEEEEEEccccHHHHHHTTccccccEEEEEEEEcTTHHHHHHHHHHHHccEEEEEEETTTTEcTTccEEEEEcHEEEEEEccHHHHHHHHHHHHHHHHHHHccEEcccEEEccccccEEccccHHHHTcTTccTTccEEEEEEcHHHHHHHHHHHHHHcccEEEEEEccccTTccEEEEEEcccccTTHHHHHHHHHHHHHHHcc### DISOP:02AL 1-5, 215-217| PSIPRED cccccccccEEEEEEEccccHHHHHHHcccccEEEEEEEEcccccccEEHHHHHHccccEEEEEccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEccccccEEEEEEEEccHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHccccc //