[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : eutN
DDBJ      :eutN         ethanolamine utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.15
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->87 2qw7H PDBj 5e-12 34.5 %
:RPS:SCOP  2->88 2hd3A1  b.40.15.1 * 6e-18 23.0 %
:RPS:PFM   1->83 PF03319 * EutN_CcmL 3e-10 42.2 %
:HMM:PFM   1->83 PF03319 * EutN_CcmL 8.5e-36 55.4 83/83  
:BLT:SWISS 1->87 CCML_SYNY3 2e-11 34.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80613.1 GT:GENE eutN GT:PRODUCT ethanolamine utilization protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1108622..1108894 GB:FROM 1108622 GB:TO 1108894 GB:DIRECTION + GB:GENE eutN GB:PRODUCT ethanolamine utilization protein GB:NOTE 90 aa, similar to sp:EUTN_SALTY ETHANOLAMINE UTILIZATION PROTEIN EUTN from Salmonella typhimurium (100 aa); 34.5% identity in 87 aa overlap CPE0907 GB:PROTEIN_ID BAB80613.1 LENGTH 90 SQ:AASEQ MEIGRVVGNVWATRKDEKLNGQKFLIVKLLVSKDKEKEGLFVAADNAGAGIGDIVLITKGGAARQSIGNREVPIDAAIVGIVDSIDIEED GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|CCML_SYNY3|2e-11|34.5|87/100| SEG 43->54|aadnagagigdi| BL:PDB:NREP 1 BL:PDB:REP 1->87|2qw7H|5e-12|34.5|87/98| RP:PFM:NREP 1 RP:PFM:REP 1->83|PF03319|3e-10|42.2|83/83|EutN_CcmL| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF03319|8.5e-36|55.4|83/83|EutN_CcmL| RP:SCP:NREP 1 RP:SCP:REP 2->88|2hd3A1|6e-18|23.0|87/95|b.40.15.1| OP:NHOMO 53 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------------------------------------------------------------1-------------11--------------1-1------------------------------------------------------1---111111----------------------1-----------------------------------------------------------1----------23--1111111111-111111-3---------33-2----1-1-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 96.7 SQ:SECSTR cEEEEEEEEcccccccGGGTTcEEEEEEEEcTTccEEEEEEEEEEcccccTTcEEEEEEGGGGGccTTcTTccccEEEEEEccEEEc### DISOP:02AL 89-90| PSIPRED cEEEEEEccEEEEEEEccccccEEEEEEEEcccccccccEEEEEEccccccccEEEEEcccccccccccccccEEEEEEEEEEEEEEccc //