[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : eutQ
DDBJ      :eutQ         ethanolamine utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->153 2pytA PDBj 4e-15 46.7 %
:RPS:PDB   37->147 3bcwA PDBj 7e-11 19.1 %
:RPS:SCOP  74->149 1o5uA  b.82.1.8 * 2e-17 27.6 %
:HMM:SCOP  37->151 1sfnA_ b.82.1.11 * 3.2e-15 20.9 %
:RPS:PFM   56->153 PF06249 * EutQ 4e-36 63.3 %
:HMM:PFM   4->155 PF06249 * EutQ 2.5e-85 69.7 152/152  
:BLT:SWISS 5->155 EUTQ_SALTY 3e-23 37.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80616.1 GT:GENE eutQ GT:PRODUCT ethanolamine utilization protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1110601..1111074 GB:FROM 1110601 GB:TO 1111074 GB:DIRECTION + GB:GENE eutQ GB:PRODUCT ethanolamine utilization protein GB:NOTE 157 aa, similar to sp:EUTQ_SALTY ETHANOLAMINE UTILIZATION PROTEIN EUTQ from Salmonella typhimurium (229 aa); 36.4% identity in 151 aa overlap CPE0910 GB:PROTEIN_ID BAB80616.1 LENGTH 157 SQ:AASEQ MENISKELLEKLVRQIIEEKLAGAGNNDSVDFIRNKDKSGIMSIKLPTVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAGIMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWASQA GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 5->155|EUTQ_SALTY|3e-23|37.4|147/229| BL:PDB:NREP 1 BL:PDB:REP 38->153|2pytA|4e-15|46.7|107/122| RP:PDB:NREP 1 RP:PDB:REP 37->147|3bcwA|7e-11|19.1|110/116| RP:PFM:NREP 1 RP:PFM:REP 56->153|PF06249|4e-36|63.3|98/122|EutQ| HM:PFM:NREP 1 HM:PFM:REP 4->155|PF06249|2.5e-85|69.7|152/152|EutQ| RP:SCP:NREP 1 RP:SCP:REP 74->149|1o5uA|2e-17|27.6|76/88|b.82.1.8| HM:SCP:REP 37->151|1sfnA_|3.2e-15|20.9|115/245|b.82.1.11|1/1|RmlC-like cupins| OP:NHOMO 91 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------111111----------------------1-----------------------------------------------------------1-----------2--1111111111-1---11-22--------22-2-----------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------1------1111111111-1111111111111111111111-----1111111111111111-11----1--------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 89.8 SQ:SECSTR ###############EEcHHHHHTccGGGEEEEEcccTTccccccccccccEEEccccEcEEEcccEEEEEEEEETTTTEEEEEEEEEEEEEEccTTEEEEEEEEEEEEEEEcTTccEEEEETTcEEEcTTcccEEEEEEEEEEEEEEcccTcccc# DISOP:02AL 1-2, 24-38, 154-157| PSIPRED cccccHHHHHHHHHHHHHHHHccccccccccEEEEcccccEEEEEccEEEEEEcccccccccccEEEEEEEEcccccccEEEEEEEEcccEEEEEEcccEEEEEEEEEEEEEEccEEEEEEccEEEEEccccEEEEEEcccEEEEEEEEcccccccc //