[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : fhuC.1
DDBJ      :fhuC         ferrichrome ABC transporter
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:259 amino acids
:PSIPRED
:BLT:PDB   26->222 1l2tB PDBj 4e-30 39.3 %
:RPS:PDB   2->229 3b5jA PDBj 2e-43 27.1 %
:RPS:SCOP  13->236 1l7vC  c.37.1.12 * 4e-38 27.7 %
:HMM:SCOP  1->229 1xew.1 c.37.1.12 * 7e-60 33.3 %
:RPS:PFM   42->167 PF00005 * ABC_tran 3e-12 35.8 %
:HMM:PFM   42->167 PF00005 * ABC_tran 1.5e-20 34.2 114/118  
:HMM:PFM   13->59 PF03193 * DUF258 1.1e-06 28.3 46/161  
:BLT:SWISS 5->242 FHUC_BACSU 2e-57 43.9 %
:PROS 139->153|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79931.1 GT:GENE fhuC.1 GT:PRODUCT ferrichrome ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 296437..297216 GB:FROM 296437 GB:TO 297216 GB:DIRECTION + GB:GENE fhuC GB:PRODUCT ferrichrome ABC transporter GB:NOTE 259 aa, similar to gpu:AP001518_126 ferrichrome ABC transporter (ATP-binding protein) from Bacillus halodurans (256 aa); 48.4% identity in 250 aa overlap ATP-binding protein CPE0225 GB:PROTEIN_ID BAB79931.1 LENGTH 259 SQ:AASEQ MIRGEKLSFNYKGEKNIINDLNIDIKEGEITTIIGPNGSGKSTLLSLLCALNKSKTGHVYLGDINMNNLKYKDIAKILATVHQQNSVPKDIKVEELVAYGRYPHKGYFKSNNKEDKNIIKWALECTGLDDLKHKGVMNLSGGERQRAFISMALAQKPKILFLDEPTTYLDIFHQIEILEIVKKLNKYNGLTVVMVLHDINQAIKYSHNIVVMKDGKIVKEGKSENVIDENLLKEVYKVNGVINKCKETGETYFIPKTIC GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 5->242|FHUC_BACSU|2e-57|43.9|237/269| PROS 139->153|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 16->25|niindlnidi| BL:PDB:NREP 1 BL:PDB:REP 26->222|1l2tB|4e-30|39.3|191/232| RP:PDB:NREP 1 RP:PDB:REP 2->229|3b5jA|2e-43|27.1|225/243| RP:PFM:NREP 1 RP:PFM:REP 42->167|PF00005|3e-12|35.8|123/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->167|PF00005|1.5e-20|34.2|114/118|ABC_tran| HM:PFM:REP 13->59|PF03193|1.1e-06|28.3|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 13->236|1l7vC|4e-38|27.7|213/231|c.37.1.12| HM:SCP:REP 1->229|1xew.1|7e-60|33.3|222/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 44436 OP:NHOMOORG 1175 OP:PATTERN SSLCQILMbaYWaVcQgJPOKNJUjMQbeLdRIADDFEIGHFESYRTjMR**h9SdSQWNTLIEZ298 JUZG*YWVkkmRXMPMNGG-GZ88P*GGGGGJmgggk***KhLqbviWhbVPuqtMMaBCfkff*hp***VWTTTnZXXNtZeCBEABUUTJ7JADG--EFQIKJaISIS6788887BBB9999GROHQULKTNXRaggssJIKyQmjisXXeXeRSJDIEJGXdTd***aMODKNMJNKNEKZRVMMwmBVes********z***********z***fkv**eiruupps**WjjjkjhhijjjjijXjecXyaYTvtWNXSZkiOPuwYXSWogaggnnrjmiprwwopnmhhorkomVVXWWVWXXWVVWwoncbcompkr***********n*qu***dnmi*uj*suiiSL**seVbioRWmespKhfSOZROOIMONLNUO***OMe****x*******y***-bf*aW*Y***MA**************GGHv*********NMNNNNNNdNOCKWRs66565666646767AB66885566886A6KBAEADw**r*******sssso****zuxwf****v**v8Kmmg*cmfj*v****UfcGTJMeTJKIIJHINLJSacXv*NeTncQcvWVhHbWZPQSaUWTRLQenYwLMMSGJIJMJGBBECDDDDDGOGFKJIlgoPlQbGSMuNOSTPKRaTRQSPUVUUWW6-BGOLL321433*r**Q*ww***x***wv-*wvy*x*x****zvvvvvr*****lmfnohjklmlmnkjmjjk*qmottttR4************44HGCEBCDKLNKIH*k*aZZYYXKOPNNVOUeMOQQOHWGMViZjkhll***q**tvc***EFFEEHFEFJjqp*pppqpy*z**KLMGKIGJIJCBCB78GWOOHIII99899999*BbFCCEF-EFFCMHEPOLCIPDFGBBDhj*XZq*ssqEUL 3444loC1SG89KSODBE98FIBJDMGDDAA89FCE7GEFDDDBB9BFGKGELDDFC6899888A79B27D7ABEBA29D9BAA5D67-EK7BB7C989768ARNI5PUmVTSPdXTFBDAGTIkdCp9**h3dPiHDI7ZAIXO7I988RC9*DSQMjIb*GkOT7sSW*ndXJAHCE*BBABLtce*D*jKFoiwnH ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED cEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHcEEcccccccccccHHHHHHccccHHHHcccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHccEEEEEEcccccEEEEEEEccc //