[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : folD
DDBJ      :folD         methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase
Swiss-Prot:FOLD_CLOPE   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:277 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->261 1b0aA PDBj 5e-45 36.7 %
:RPS:PDB   3->272 2c2xA PDBj 3e-36 33.1 %
:RPS:SCOP  3->145 1edzA2  c.58.1.2 * 8e-25 19.3 %
:RPS:SCOP  124->272 1a4iA1  c.2.1.7 * 5e-11 39.7 %
:HMM:SCOP  1->120 1b0aA2 c.58.1.2 * 2.1e-30 49.2 %
:HMM:SCOP  121->274 1a4iA1 c.2.1.7 * 7.3e-46 37.0 %
:RPS:PFM   4->119 PF00763 * THF_DHG_CYH 5e-17 40.5 %
:RPS:PFM   125->261 PF02882 * THF_DHG_CYH_C 5e-39 54.0 %
:HMM:PFM   123->275 PF02882 * THF_DHG_CYH_C 8e-70 54.9 153/161  
:HMM:PFM   3->119 PF00763 * THF_DHG_CYH 3.8e-37 50.4 117/117  
:BLT:SWISS 1->277 FOLD_CLOPE e-135 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81529.1 GT:GENE folD GT:PRODUCT methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2101416..2102249) GB:FROM 2101416 GB:TO 2102249 GB:DIRECTION - GB:GENE folD GB:PRODUCT methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase GB:NOTE 277 aa, similar to sp:FOLD_BACSU FOLD BIFUNCTIONAL PROTEIN [INCLUDES: METHYLENETETRAHYDROFOLATE DEHYDROGENASE (EC 1.5.1.5) from Bacillus subtilis (283 aa); 44.6% identity in 271 aa overlap CPE1823 GB:PROTEIN_ID BAB81529.1 LENGTH 277 SQ:AASEQ MDKILSGKTVAIDIKGQIKSYTEELKASGKSLKISSILVGDDGGSVYYQNFQEKLANNLGIDFEKIKLDESISEENLKLKIEELNKDDSVNGIMLLLPLPKHIDERAVTNLIDADKDLDCLSEVSVGRFYKGEKCFMPCTPNSVITLLKAYNIEIEGKEVVIIGRSNIVGKPLFQMFLNENATVTVCHSRTKNLKEVCKRADILVVAIGRANFIDSSYVREGAVVIDVGTSEVNGKITGDVNFDDVYDKASLITPVPGGVGSLTTTLLLKNVCKELD GT:EXON 1|1-277:0| SW:ID FOLD_CLOPE SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=CPE1823; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->277|FOLD_CLOPE|e-135|100.0|277/277| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| SEG 74->86|eenlklkieelnk| SEG 153->164|ieiegkevviig| SEG 263->269|ltttlll| BL:PDB:NREP 1 BL:PDB:REP 3->261|1b0aA|5e-45|36.7|259/287| RP:PDB:NREP 1 RP:PDB:REP 3->272|2c2xA|3e-36|33.1|269/280| RP:PFM:NREP 2 RP:PFM:REP 4->119|PF00763|5e-17|40.5|116/118|THF_DHG_CYH| RP:PFM:REP 125->261|PF02882|5e-39|54.0|137/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 123->275|PF02882|8e-70|54.9|153/161|THF_DHG_CYH_C| HM:PFM:REP 3->119|PF00763|3.8e-37|50.4|117/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 3->145|1edzA2|8e-25|19.3|140/146|c.58.1.2| RP:SCP:REP 124->272|1a4iA1|5e-11|39.7|146/160|c.2.1.7| HM:SCP:REP 1->120|1b0aA2|2.1e-30|49.2|120/121|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 121->274|1a4iA1|7.3e-46|37.0|154/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1481 OP:NHOMOORG 1099 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--11111111111111111111111111-1111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111121111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-1-1---11111111-1111111111111 ----331-311-11111-1-222222111111111212221221111222111111111111333222223232322-2223333222-111111111112-1424-15243744533142233352A1AQ4-5343332413342332131253443333223242633B21121333W222216343-431133332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 98.9 SQ:SECSTR ccEEccHHHHHHHHHHHHHHHHHHHHHTTcccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEEEEEEcTTccHHHHHHHHHHHHHcTTccEEEEcccccTTccHHHHHHHccGGGcTTcccHHHHHHHHHTccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHTcTccEEEEEcTTcccHHHHHTTccEEEEccccTTcccGGGccTTcEEEEccETEEETTEEEEcccGGGGGTccEEEccccccHHHHHHHHHHHHHH### PSIPRED ccEEEcHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccHHHccccccHHHHHHHHccccccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHccEEEEcccccccccHHHcccccEEEEEEccccccEEEEEEcHHHHHHHccEEcccccccHHHHHHHHHHHHHHHcc //