[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : ftsW
DDBJ      :ftsW         probable cell division protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  835/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:409 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   66->409 PF01098 * FTSW_RODA_SPOVE 5e-45 37.4 %
:HMM:PFM   79->406 PF01098 * FTSW_RODA_SPOVE 1.4e-79 36.5 323/359  
:BLT:SWISS 89->389 FTSW_MYCTU 6e-40 31.4 %
:PROS 339->345|PS00485|A_DEAMINASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80056.1 GT:GENE ftsW GT:PRODUCT probable cell division protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 444998..446227 GB:FROM 444998 GB:TO 446227 GB:DIRECTION + GB:GENE ftsW GB:PRODUCT probable cell division protein GB:NOTE 409 aa, similar to sp:FTSW_MYCTU PROBABLE CELL DIVISION PROTEIN FTSW from Mycobacterium tuberculosis (469 aa); 35.6% identity in 354 aa overlap. Putative N-terminal signal sequence and 8 putative transmembrane regions were found by PSORT. CPE0350 GB:PROTEIN_ID BAB80056.1 LENGTH 409 SQ:AASEQ MNTTLKYEKRMLLLVYLLCLALFTNIAVKQTPIDKMAFIIAGILIIIIGFSHFIIRKFYPDGDKYMLIFASVLAVVGIAVLYRLDPKLAIKQLVWFSLGIALYMGIVIVMPDLKSFAKYKYIYMGGTLIFMAMAMIIGKTVNGSKNWVYIGSFGFQPSEIGKIFLILYLASALMKYEKKDNIKYEFKQLLEPALVVMYSLGFMVLQKDLGSALMFFFVSITMLYIATCNWKYVGTGLVLFSLGGTVSYFLFSHVKKRVMIWKDVWKYASNESYQIVQGFYAMSLGGMFGTGLYNGYPKLVPFASTDFIFTLIAQELGLVFGIGLLLLYFLLFYRGIRAALNTDDPFSQLNAVGFSTLIVAQVLVIIGGVFAVIPLTGITLPLVSYGGTSMLTVFIALGILQKISEEGLR GT:EXON 1|1-409:0| BL:SWS:NREP 1 BL:SWS:REP 89->389|FTSW_MYCTU|6e-40|31.4|299/469| PROS 339->345|PS00485|A_DEAMINASE|PDOC00419| TM:NTM 11 TM:REGION 11->32| TM:REGION 34->55| TM:REGION 65->87| TM:REGION 92->114| TM:REGION 122->144| TM:REGION 185->207| TM:REGION 209->231| TM:REGION 233->254| TM:REGION 307->329| TM:REGION 355->377| TM:REGION 385->407| SEG 12->22|lllvyllclal| SEG 37->55|afiiagiliiiigfshfii| SEG 316->337|lglvfgigllllyfllfyrgir| RP:PFM:NREP 1 RP:PFM:REP 66->409|PF01098|5e-45|37.4|340/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 79->406|PF01098|1.4e-79|36.5|323/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 1592 OP:NHOMOORG 836 OP:PATTERN -------------------------------------------------------------------- 2231322222222112211-1222221111122222232223331121211222122222122121234332111222333322222211-121111--1-1111121222222222112111111122112111133344---3222222211212111112211122221112212122121--111223343343444444445444366425443335322455554331222222222222223222242322222222222211-12122211222211112222222222222111111111111122222222222333444444443443233333333323333224433322213333212212-222211111111111111111111111111111-11111111112111111111111111221111-1---11222222222222222122--------222222222222222212111112222222222222122222222222222222222222222221222221121-2221222-------22122222222221212222222222221222222221122211111--111111111-1-22112221222222222222223222222322221-211111--11122222222222222222-22322222222221222222222221222222222222222222222222222222222222222122222222222221122222222222222222222222222222111122222222221211--------233322222222111322222211111112-22112211-11-12-122--------------------------11122222222-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 407-409| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccEEEEEccccEEcHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHHHHccccEEEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccHHHHHHHHHHHHHHHHHHHHHcc //