[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : galE.1
DDBJ      :galE         UDP-glucose 4-epimerase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  824/915 : Eukaryota  186/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->328 2c20A PDBj e-120 62.4 %
:RPS:PDB   1->327 1a9zA PDBj 2e-45 43.3 %
:RPS:SCOP  3->319 1sb8A  c.2.1.2 * 6e-62 25.2 %
:HMM:SCOP  1->328 1gy8A_ c.2.1.2 * 2.8e-95 40.7 %
:RPS:PFM   3->237 PF01370 * Epimerase 6e-39 46.1 %
:HMM:PFM   3->251 PF01370 * Epimerase 1.8e-60 39.5 233/238  
:BLT:SWISS 1->326 GALE_BACHD e-127 63.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79992.1 GT:GENE galE.1 GT:PRODUCT UDP-glucose 4-epimerase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(365742..366728) GB:FROM 365742 GB:TO 366728 GB:DIRECTION - GB:GENE galE GB:PRODUCT UDP-glucose 4-epimerase GB:NOTE 328 aa, similar to gpu:AP001510_283 UDP-glucose 4-epimerase from Bacillus halodurans (334 aa); 63.5% identity in 326 aa overlap CPE0286 GB:PROTEIN_ID BAB79992.1 LENGTH 328 SQ:AASEQ MAILVCGGAGYIGSHMVAELIENNKEVVILDNFEKGHEDAILGGKLYKGDLRDRKILDKIFTENNIEAVIDFAAYSLVGESMTEPLKYFNNNVSGTISLLEAMRDHNVKYIVFSSTAATYGEPENIPILETDKNLPTNAYGESKLLVEKILKWCDTAYGIKYTALRYFNAAGAHVNGKIGEDHSPETHLIPLILQVALGKRDKIMMFGDDYDTKDGTCVRDYIHVSDLASAHSLALERLMNGGESRIYNLGNGTGFTVKEVVEVARKVTGHPIPAEVAPRRAGDPAILIASSDKAIEELNWKPKFNSLETIIETAWNWHKNHPNGYEK GT:EXON 1|1-328:0| BL:SWS:NREP 1 BL:SWS:REP 1->326|GALE_BACHD|e-127|63.5|326/334| BL:PDB:NREP 1 BL:PDB:REP 2->328|2c20A|e-120|62.4|327/329| RP:PDB:NREP 1 RP:PDB:REP 1->327|1a9zA|2e-45|43.3|326/338| RP:PFM:NREP 1 RP:PFM:REP 3->237|PF01370|6e-39|46.1|219/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 3->251|PF01370|1.8e-60|39.5|233/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 3->319|1sb8A|6e-62|25.2|301/341|c.2.1.2| HM:SCP:REP 1->328|1gy8A_|2.8e-95|40.7|327/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4302 OP:NHOMOORG 1079 OP:PATTERN 11311-32344335312412134393347453355226141224446767565133322332243-14 67B2B22433511123433-312233333332223223253A7824211453554213116321746747333333342122836964A86425221--43455656985--------------544433654554BDDAD-11A38567776223364433335466674634433555445323112241354454598654858983555544483522343111211582111111111111113---15111442331334114335223221123223333333442422432411111111111112324432222331856665666645614444425181-52132239575233312122523977446-----35A855335545C43334343424-778C7C8A59326553CG6BECAB5542323399AA43-2222222233434874-------------------------1-2-2244315663376646745555668866664535657542344371234224432335432255225545344565444548389555987696855596775565A98444313325332412112123232265666332333142245323222323423213--17533------34453453554345463-5634455644533233435533324444455555444564654646333343-4344444344451-4-333331111425422221122321221124223213323633253454234545246623332233341455111112524635334332224434--96557799111111112-1----------1-1---13-1-----1133521221565 --22223-321146622352342343411211111111111111113311556723223333321-11-2-12-211-2212222233-23322523232222456-5D3644434232-213352242DC4-443233-31342223114213143358A957432234N45438656*C9954SMUS3VJ7896766 -----------------------2--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 328 STR:RPRED 100.0 SQ:SECSTR cEEEEETTTcHHHHHHHHHHHHTTcEEEEEEccccccTTHHHHHHHHHTcTTcHHHHHHHHHHTTccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEGGGGcccccccccTTcccccccHHHHHHHHHHHHHHHHHHHcTTcEEEEEEcEEEcccTTccccccccccccHHHHHHHHHTTccccEEEEcccccccccccEEcEEEHHHHHHHHHHHHHHHTTccEEEEEEEcccccEEHHHHHHHHHHHHTccccEEEEcccTTcccccccccHHHHHHHccccccccHHHHHHHHHHHHHHcTTcccH DISOP:02AL 327-328| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccHHHHccccEEEEEcccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccccccccEEEcEEEHHHHHHHHHHHHHHHccccccEEEEEcccccEEHHHHHHHHHHHHcccccEEEcccccccHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHccc //