[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : gmk.2
DDBJ      :gmk          probable guanylate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->96 2qorA PDBj 3e-11 37.1 %
:RPS:PDB   1->79 2dufA PDBj 1e-07 8.9 %
:RPS:SCOP  1->27 1jjvA  c.37.1.1 * 9e-06 33.3 %
:RPS:SCOP  11->193 1jxmA2  c.37.1.1 * 6e-13 20.1 %
:HMM:SCOP  2->193 1kjwA2 c.37.1.1 * 1.9e-32 22.9 %
:RPS:PFM   3->101 PF00625 * Guanylate_kin 3e-09 31.2 %
:HMM:PFM   2->172 PF00625 * Guanylate_kin 3.7e-18 22.4 165/183  
:BLT:SWISS 2->79 KGUA_CLOD6 3e-13 44.2 %
:PROS 37->54|PS00856|GUANYLATE_KINASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82158.1 GT:GENE gmk.2 GT:PRODUCT probable guanylate kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2798306..2798896) GB:FROM 2798306 GB:TO 2798896 GB:DIRECTION - GB:GENE gmk GB:PRODUCT probable guanylate kinase GB:NOTE 196 aa, similar to prf:2407216B ORF from Bacillus natto (182 aa); 30.4% identity in 158 aa overlap CPE2452 GB:PROTEIN_ID BAB82158.1 LENGTH 196 SQ:AASEQ MGKIFCIMGKSGSGKDTILKEINKVEDLNLKTIVTYTTRPKRNNETDGVEYFFIDKEKLDDFNREGKIIECRVYDTVHGKWYYLTVDDGQINLEENNYIVIVTLEAYSEFRKYFGDEKLVPLYIDLDDGVRLERALKREREQKSPNYNEMCRRFLADNEDFSEDKLLNNNIIKKYNNYNLEECISEICDVIRKTSK GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 2->79|KGUA_CLOD6|3e-13|44.2|77/205| PROS 37->54|PS00856|GUANYLATE_KINASE_1|PDOC00670| SEG 165->180|kllnnniikkynnynl| BL:PDB:NREP 1 BL:PDB:REP 7->96|2qorA|3e-11|37.1|89/192| RP:PDB:NREP 1 RP:PDB:REP 1->79|2dufA|1e-07|8.9|79/225| RP:PFM:NREP 1 RP:PFM:REP 3->101|PF00625|3e-09|31.2|96/183|Guanylate_kin| HM:PFM:NREP 1 HM:PFM:REP 2->172|PF00625|3.7e-18|22.4|165/183|Guanylate_kin| RP:SCP:NREP 2 RP:SCP:REP 1->27|1jjvA|9e-06|33.3|27/194|c.37.1.1| RP:SCP:REP 11->193|1jxmA2|6e-13|20.1|169/199|c.37.1.1| HM:SCP:REP 2->193|1kjwA2|1.9e-32|22.9|179/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 45 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------111------111--------------------------------------------------------------------------------------------11-1--------------------------11---------------------------------1-----------------------------------------------------------111---111---12------------1---1111-----11-----1-----------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------11111-111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 78.6 SQ:SECSTR EEEEEEEETTTTEEEEEEEEEEEcTTccEEEEEEEEEEEEcccccccccccEEEEEEEEccTTccccEEEEEEEEEEEcEEcHHHHHHHHHGEccccccEEEEEEccHHHHTHHHHHHHHTTcccHHHHHHHHHHccccHHHTTTHHHHTcTTH########################################## DISOP:02AL 135-149| PSIPRED cccEEEEEccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHccccEEEEHHHHHccccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHcc //