[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : guaB
DDBJ      :guaB         probable inosine-5'-monophosphate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->134 2emqA PDBj 2e-09 22.6 %
:RPS:PDB   11->134 3c1yA PDBj 4e-13 8.9 %
:RPS:SCOP  7->127 1yavA3  d.37.1.1 * 1e-17 20.0 %
:HMM:SCOP  1->62 1yavA1 d.37.1.1 * 3e-08 27.4 %
:HMM:SCOP  63->132 1yavA2 d.37.1.1 * 1.8e-12 27.5 %
:RPS:PFM   19->124 PF00478 * IMPDH 2e-04 28.7 %
:HMM:PFM   19->56 PF00571 * CBS 4.1e-10 34.2 38/57  
:HMM:PFM   86->127 PF00571 * CBS 4e-09 26.2 42/57  
:BLT:SWISS 17->125 Y1426_METJA 3e-07 35.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81859.1 GT:GENE guaB GT:PRODUCT probable inosine-5'-monophosphate dehydrogenase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2464973..2465383) GB:FROM 2464973 GB:TO 2465383 GB:DIRECTION - GB:GENE guaB GB:PRODUCT probable inosine-5'-monophosphate dehydrogenase GB:NOTE 136 aa, similar to gpu:AP001516_139 inosine-5'-monophosphate dehydrogenase from Bacillus halodurans (144 aa); 64% identity in 136 aa overlap CPE2153 GB:PROTEIN_ID BAB81859.1 LENGTH 136 SQ:AASEQ MNIAFFLTPKSEVAYEYTDATMRQVIERMEHHGYTAIPLIDKTGKYVGTLTEGDLLWTLKRNPELNFKNTNTVSVKEIPRRVKHKSVCINENMESLISLAISQNFVPVVDDNGIFIGIIKRSDIINHCYNSLYKNN GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 17->125|Y1426_METJA|3e-07|35.8|106/168| BL:PDB:NREP 1 BL:PDB:REP 1->134|2emqA|2e-09|22.6|133/135| RP:PDB:NREP 1 RP:PDB:REP 11->134|3c1yA|4e-13|8.9|124/349| RP:PFM:NREP 1 RP:PFM:REP 19->124|PF00478|2e-04|28.7|94/459|IMPDH| HM:PFM:NREP 2 HM:PFM:REP 19->56|PF00571|4.1e-10|34.2|38/57|CBS| HM:PFM:REP 86->127|PF00571|4e-09|26.2|42/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 7->127|1yavA3|1e-17|20.0|120/132|d.37.1.1| HM:SCP:REP 1->62|1yavA1|3e-08|27.4|62/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 63->132|1yavA2|1.8e-12|27.5|69/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 32 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------11-------1---------------------1---------------------------------------------------------------------2-211111111111-11111111-------1-11-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 100.0 SQ:SECSTR ccTccccGTcHHHGGGcTTcHHHHHHHHHHHTTccEEEEEcccGGGGTTTEEccEEEEEEccHHHHHHHTTcccEEEEcTTccEEEEEEEEEcccTTcccccccHHHHHHHHccEEEEEccccccEEEEccccEcc DISOP:02AL 132-136| PSIPRED cEEEEEEEccccEEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHcccccccccccccEEEEcccccccEEEccccHHHHHHHHHHHcccEEEEEcccEEEEEEEHHHHHHHHHHHHHccc //